(data stored in ACNUC7421 zone)

EMBL: CP000821.PE556

CP000821.PE556       Location/Qualifiers
FT   CDS             675290..678010
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0557"
FT                   /product="MSHA biogenesis protein MshQ"
FT                   /note="KEGG: slo:Shew_0402 MSHA biogenesis protein MshQ"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35169"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQP6"
FT                   /protein_id="ABV35169.1"
FT                   /translation="MFKIVLSLALLFPALAIAVPYCSDIFTDPPTGDHGENGLTPPANI
FT                   GPPLGDLNCTRKRGCDNSTSGYFLPGDYSFSEGNFHGGGPSLVNHITTNGTTARLYFDR
FT                   VSLSGVSLNTYGKAEDLIIYVREDLTIAGHNHINGIIYVVGNVSLTGNGSVTGGLAAGG
FT                   SAGVGGNGDFVFDEEAIDNADFGGMCIPGPKPDLNHYRLEFSSGALSCKAKDILIRACA
FT                   DEYCATETSVLSSVDLTKNGGVYSTVNFAGHTVPAAELWHADGGTVLVGLGATAPSAPY
FT                   RCFIDGLEVANIADCQLTFEDTGFYFDAPDTISYKDSGQFELFAATKDPVTQKCESLFK
FT                   NQTKSVDFSFNYKDPNPVNNPASLMLTAPTQSKVIAGGDTESVSVKFDAEGKALLTVNY
FT                   PEAGEVTLKASHTHTVNTPNGSEELVLEHQDSFVAKPAGFHFFNESANNRCASSDPYDA
FT                   DCKVLAKAGESFDMRLKAAGWTSDEDSDFSDNPVLQNFKHSNIQIQAAVEAPSLADGGT
FT                   NGSFSTSAVDFNLSGSESSQLISQSWTEVGTLTAKLTQDISYLGVTISKDNASSELFGR
FT                   FTPAYLDISGNSPSLTHSCGSFTYIDQPFGFSGGGEPIIQVRGMASDDSEARNYQLGDW
FT                   WRYKHKEEASRNQWLGRGYEDKTGELQVQDSEYPGLSGSVSYANNANTATLTGAKVEYV
FT                   RLPTPMVPFDAKFDLKLAVTDLTDEDGICYQADSSGSCQPFSFEDIADGASFELRYGRL
FT                   QLDNGYSPQSESLRLPLRTEYVSAVDAANVPTWVTNGDDSCSVYNTVTSTDTTEAVTTG
FT                   MNMTLPAGFPAITAHSNDELTSQSGTALQGVNHIYFTAPNTPGEVRLKQHVEPWLKWYW
FT                   NYDGNKPNALYDPRASAFFGTYRGHDKVIYWHEVN"
     MFKIVLSLAL LFPALAIAVP YCSDIFTDPP TGDHGENGLT PPANIGPPLG DLNCTRKRGC        60
     DNSTSGYFLP GDYSFSEGNF HGGGPSLVNH ITTNGTTARL YFDRVSLSGV SLNTYGKAED       120
     LIIYVREDLT IAGHNHINGI IYVVGNVSLT GNGSVTGGLA AGGSAGVGGN GDFVFDEEAI       180
     DNADFGGMCI PGPKPDLNHY RLEFSSGALS CKAKDILIRA CADEYCATET SVLSSVDLTK       240
     NGGVYSTVNF AGHTVPAAEL WHADGGTVLV GLGATAPSAP YRCFIDGLEV ANIADCQLTF       300
     EDTGFYFDAP DTISYKDSGQ FELFAATKDP VTQKCESLFK NQTKSVDFSF NYKDPNPVNN       360
     PASLMLTAPT QSKVIAGGDT ESVSVKFDAE GKALLTVNYP EAGEVTLKAS HTHTVNTPNG       420
     SEELVLEHQD SFVAKPAGFH FFNESANNRC ASSDPYDADC KVLAKAGESF DMRLKAAGWT       480
     SDEDSDFSDN PVLQNFKHSN IQIQAAVEAP SLADGGTNGS FSTSAVDFNL SGSESSQLIS       540
     QSWTEVGTLT AKLTQDISYL GVTISKDNAS SELFGRFTPA YLDISGNSPS LTHSCGSFTY       600
     IDQPFGFSGG GEPIIQVRGM ASDDSEARNY QLGDWWRYKH KEEASRNQWL GRGYEDKTGE       660
     LQVQDSEYPG LSGSVSYANN ANTATLTGAK VEYVRLPTPM VPFDAKFDLK LAVTDLTDED       720
     GICYQADSSG SCQPFSFEDI ADGASFELRY GRLQLDNGYS PQSESLRLPL RTEYVSAVDA       780
     ANVPTWVTNG DDSCSVYNTV TSTDTTEAVT TGMNMTLPAG FPAITAHSND ELTSQSGTAL       840
     QGVNHIYFTA PNTPGEVRLK QHVEPWLKWY WNYDGNKPNA LYDPRASAFF GTYRGHDKVI       900
     YWHEVN                                                                  906
//

If you have problems or comments...

PBIL Back to PBIL home page