(data stored in ACNUC7421 zone)

EMBL: CP000821.PE557

CP000821.PE557       Location/Qualifiers
FT   CDS             678219..679268
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0558"
FT                   /product="cell shape determining protein, MreB/Mrl family"
FT                   /note="KEGG: slo:Shew_0403 cell shape determining protein,
FT                   MreB/Mrl family"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35170"
FT                   /db_xref="GOA:A8FQP7"
FT                   /db_xref="InterPro:IPR004753"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQP7"
FT                   /protein_id="ABV35170.1"
FT                   /translation="MFKKLRGIFSNDLSIDLGTANTLIYVREEGIVLNEPSVVAIRGER
FT                   GSGGQKSVAAVGTEAKQMLGRTPGNIQAIRPMKDGVIADFYVTEKMLQHFIKQVHNNSV
FT                   FRPSPRVLVCVPVGATQVERRAIRESAMGAGAREVYLIEEPMAAAIGAGLPVSEATGSM
FT                   VVDIGGGTTEVAIISLNGVVYSSSVRIGGDKFDDAIINYVRRNYGSLIGEATAERIKHT
FT                   IGTAYPGDEVLEIEVRGRNLAEGVPRSFTLNSNEILEALQEPLSGIVSAVMVALEQSPP
FT                   ELASDISERGMVLTGGGALIRDLDRLLMQETGIPVMVADDPLTCVARGGGKALEMIDMH
FT                   GGDLFSEES"
     MFKKLRGIFS NDLSIDLGTA NTLIYVREEG IVLNEPSVVA IRGERGSGGQ KSVAAVGTEA        60
     KQMLGRTPGN IQAIRPMKDG VIADFYVTEK MLQHFIKQVH NNSVFRPSPR VLVCVPVGAT       120
     QVERRAIRES AMGAGAREVY LIEEPMAAAI GAGLPVSEAT GSMVVDIGGG TTEVAIISLN       180
     GVVYSSSVRI GGDKFDDAII NYVRRNYGSL IGEATAERIK HTIGTAYPGD EVLEIEVRGR       240
     NLAEGVPRSF TLNSNEILEA LQEPLSGIVS AVMVALEQSP PELASDISER GMVLTGGGAL       300
     IRDLDRLLMQ ETGIPVMVAD DPLTCVARGG GKALEMIDMH GGDLFSEES                   349
//

If you have problems or comments...

PBIL Back to PBIL home page