(data stored in ACNUC7421 zone)

EMBL: CP000821.PE558

CP000821.PE558       Location/Qualifiers
FT   CDS             679407..680303
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0559"
FT                   /product="rod shape-determining protein MreC"
FT                   /note="KEGG: slo:Shew_0404 rod shape-determining protein
FT                   MreC"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35171"
FT                   /db_xref="GOA:A8FQP8"
FT                   /db_xref="InterPro:IPR007221"
FT                   /db_xref="InterPro:IPR042175"
FT                   /db_xref="InterPro:IPR042177"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQP8"
FT                   /protein_id="ABV35171.1"
FT                   /translation="MKPIFARGISNQFRLTLAIILSVILIVANNRLDPVRKSVSSVLSP
FT                   LQYVANVPGALLDWSAESLATRNMLTKQNKELLRQQLLMSERLQRFEHLRQENDRLRAL
FT                   LGSPVHMDSKKVVAEVMEVASDPYHQYVVLNHGAMSGVFVGQPVVDAQGVVGQVVQVNE
FT                   LTSRVLLISDATHGIPVRVTRNDVRLVVKGTGVLDELELSYVSKSTDIRVGDLLVSSGL
FT                   GNRFPEGYPVARVMSVVKDDGQSYANVIAQPLAALDRIRYLLLIWPDEQDESLSKDELL
FT                   NIENTSESTKQTAEVSQ"
     MKPIFARGIS NQFRLTLAII LSVILIVANN RLDPVRKSVS SVLSPLQYVA NVPGALLDWS        60
     AESLATRNML TKQNKELLRQ QLLMSERLQR FEHLRQENDR LRALLGSPVH MDSKKVVAEV       120
     MEVASDPYHQ YVVLNHGAMS GVFVGQPVVD AQGVVGQVVQ VNELTSRVLL ISDATHGIPV       180
     RVTRNDVRLV VKGTGVLDEL ELSYVSKSTD IRVGDLLVSS GLGNRFPEGY PVARVMSVVK       240
     DDGQSYANVI AQPLAALDRI RYLLLIWPDE QDESLSKDEL LNIENTSEST KQTAEVSQ         298
//

If you have problems or comments...

PBIL Back to PBIL home page