(data stored in ACNUC7421 zone)

EMBL: CP000821.PE559

CP000821.PE559       Location/Qualifiers
FT   CDS             680300..680788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0560"
FT                   /product="rod shape-determining protein MreD"
FT                   /note="KEGG: slo:Shew_0405 rod shape-determining protein
FT                   MreD"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35172"
FT                   /db_xref="GOA:A8FQP9"
FT                   /db_xref="InterPro:IPR007227"
FT                   /db_xref="InterPro:IPR026034"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQP9"
FT                   /protein_id="ABV35172.1"
FT                   /translation="MSMHIANGRWVVWLSFLVAMLFQIMPLPDLVEPWRPDWLLLVIIY
FT                   WAMALPHRYNILSAWVLGVLLDIMLGAHLGIRALSISLVVYVVVLHFQRLRNFPMWQQA
FT                   LMISSLICLYHLVIFWVQFVVDTATFDVRLFLPAISSLIIWPWVFWILRRVRRLYKVR"
     MSMHIANGRW VVWLSFLVAM LFQIMPLPDL VEPWRPDWLL LVIIYWAMAL PHRYNILSAW        60
     VLGVLLDIML GAHLGIRALS ISLVVYVVVL HFQRLRNFPM WQQALMISSL ICLYHLVIFW       120
     VQFVVDTATF DVRLFLPAIS SLIIWPWVFW ILRRVRRLYK VR                          162
//

If you have problems or comments...

PBIL Back to PBIL home page