(data stored in ACNUC7421 zone)

EMBL: CP000821.PE56

CP000821.PE56        Location/Qualifiers
FT   CDS             complement(66518..67894)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0056"
FT                   /product="flagellar hook-associated 2 domain protein"
FT                   /note="KEGG: shw:Sputw3181_0485 flagellar hook-associated 2
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34669"
FT                   /db_xref="GOA:A8FP96"
FT                   /db_xref="InterPro:IPR003481"
FT                   /db_xref="InterPro:IPR010809"
FT                   /db_xref="InterPro:IPR040026"
FT                   /db_xref="UniProtKB/TrEMBL:A8FP96"
FT                   /protein_id="ABV34669.1"
FT                   /translation="MISGMSGSQFAEQLIGAERMGKDQLYQSNMTKHQTQLDAYEILEK
FT                   SLNQMTKNLEKLDGDAFDSKTSTVSDDNASITVESGAATGSYDLYVKQLAQAHQISKSF
FT                   SGEDAALPTSGVLTIQVGPDVADTLTLDMAVYNPGGNATVSDLTGMINSHPDNPGVQAS
FT                   LVRTGGQVELMLSSTETGADSTIDVKMDGADWGMTERRAAQDAELTLNGIDIKSSSNYL
FT                   NNVIDGVSIELNKAHGVGESSTIKIESDTDASEQAVKDFVDSFNELMDQINQLTRSMGS
FT                   SVLDDINDDNDKDKDEDDDDDDDDSPSSVTEDQLGALKGDSSVRMLQNSMRSAIFDPAS
FT                   NGMRLSDIGIEMTREGKLEIDEDKLAKALKDDPGAIEAMFTGSDNYVDRMDGIIDPFTK
FT                   SNGYLDLKQENLDKQITRVEDNMARHDYQMEQRYQIYLAQFTAMEATINQLNSASALFY
FT                   "
     MISGMSGSQF AEQLIGAERM GKDQLYQSNM TKHQTQLDAY EILEKSLNQM TKNLEKLDGD        60
     AFDSKTSTVS DDNASITVES GAATGSYDLY VKQLAQAHQI SKSFSGEDAA LPTSGVLTIQ       120
     VGPDVADTLT LDMAVYNPGG NATVSDLTGM INSHPDNPGV QASLVRTGGQ VELMLSSTET       180
     GADSTIDVKM DGADWGMTER RAAQDAELTL NGIDIKSSSN YLNNVIDGVS IELNKAHGVG       240
     ESSTIKIESD TDASEQAVKD FVDSFNELMD QINQLTRSMG SSVLDDINDD NDKDKDEDDD       300
     DDDDDSPSSV TEDQLGALKG DSSVRMLQNS MRSAIFDPAS NGMRLSDIGI EMTREGKLEI       360
     DEDKLAKALK DDPGAIEAMF TGSDNYVDRM DGIIDPFTKS NGYLDLKQEN LDKQITRVED       420
     NMARHDYQME QRYQIYLAQF TAMEATINQL NSASALFY                               458
//

If you have problems or comments...

PBIL Back to PBIL home page