(data stored in ACNUC7421 zone)

EMBL: CP000821.PE560

CP000821.PE560       Location/Qualifiers
FT   CDS             680791..681387
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0561"
FT                   /product="maf protein"
FT                   /note="KEGG: slo:Shew_0406 maf protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35173"
FT                   /db_xref="GOA:A8FQQ0"
FT                   /db_xref="InterPro:IPR003697"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQQ0"
FT                   /protein_id="ABV35173.1"
FT                   /translation="MNGSARLVLASASPRRKELLTQLGFSKAGFSFDTLSADIDETHQT
FT                   GESPQVFVSRLAVEKAEAGLALCDNLTTPVVLGSDTIVVLGEQILGKPVDEADALKMLT
FT                   DLSGHIHSVMTAVALTDGKKTLTRLVETKVQFCDLNEQDILAYITTGEPMDKAGAYGIQ
FT                   ALGGSFVERIEGSYSAVVGLPLVETRELLKEMKII"
     MNGSARLVLA SASPRRKELL TQLGFSKAGF SFDTLSADID ETHQTGESPQ VFVSRLAVEK        60
     AEAGLALCDN LTTPVVLGSD TIVVLGEQIL GKPVDEADAL KMLTDLSGHI HSVMTAVALT       120
     DGKKTLTRLV ETKVQFCDLN EQDILAYITT GEPMDKAGAY GIQALGGSFV ERIEGSYSAV       180
     VGLPLVETRE LLKEMKII                                                     198
//

If you have problems or comments...

PBIL Back to PBIL home page