(data stored in ACNUC7421 zone)

EMBL: CP000821.PE562

CP000821.PE562       Location/Qualifiers
FT   CDS             682999..687258
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0563"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: slo:Shew_0408 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35175"
FT                   /db_xref="InterPro:IPR011836"
FT                   /db_xref="InterPro:IPR025263"
FT                   /db_xref="InterPro:IPR032712"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQQ2"
FT                   /protein_id="ABV35175.1"
FT                   /translation="MPRQFCPFKFSRFCWQILAIILVLFALAVSLFRGLLPQLAEVRQE
FT                   LVKYVEEQYQVQVNVGELNAEWQAFGPALTVKNLVLPPQERLPFTLIIRDVHVKLDFWE
FT                   SLMTTSPQIENVIFEGVQVGLDLDKLNQAGPSTVSAETDTDWLYRLLLEQLEHFSITEA
FT                   SLQLLSKSHDFRPIYVKDLRWQNRNNKHQGQGKLYLDEKASEVEQLSLSLEIDGNGFRP
FT                   DTLKGQVYLAASSLDLGEWASRQANPYDEKSKLPLEGVVNLQAWLSLGNRSIESGLIQF
FT                   EPSWLEWQLNEEVQHFEIKGGQFEWLPIDKGWQLSSRSLEFETNDRPWSELNFVAQQRG
FT                   EQLSAYLNRLDTSTLLPLLPLAPKVDLLALKTWQSINPQGYLDNIKFSLNGDLGPQVSL
FT                   DINQLQWRNFESIPGSKALDLQVAWYDDSLYFNAPEQAYTLDFSTAFKAPIVLNGAAFD
FT                   ARFNTQYSELTLPRLQFSNKDIGIDASVKMGFAGDTHLALLADVKINDVVDVGNYFPLH
FT                   GMDAGLVDYLEAGLVAGNTQDARVVWHGPLNQYPYKDHSGIFQAAFTLSDAEFKFQPDW
FT                   PAVTSLELSALFENARMDLTIDSGDLLDVVVDGARISIPELGARSLLEIDAELATQGVA
FT                   ATEVIQASPLAESVGSTLAVVQVQGDVTATLDLSIPLYDGEEEQIRGLVNLDNTPIYIT
FT                   EPGVQLDGVTGQVSFVNEVVKGKDISALLYQQPVSLTFDTEQVRDNYGLNLDLKGVWQL
FT                   DELPAELDNPLMDFYSGEVNWNGAMTLIFDQTGYRIQAQVNSDLLGTELTLPPPFSKAT
FT                   DEKRRLSAELIGDNKQSSLGIKLGNQMEFWGGFDLESGDQLSHFDLLLGRLFKPGDQLK
FT                   RDQGHLQLDIAQTEFSPWLPIITSFTSAATSEINLAPIVPEPQSVPETEAVSAPELNPG
FT                   EKASVQQEQTRGFFPPLISIDADIGDLNLMGQTLSELTMTAAPFEELWRFEAQSKEFDG
FT                   RIDFYPDWSTQGLKMVAKKFHIAPAVKEEAKADFKSGTVLNNLPPLALDVDDFRLYGKP
FT                   LGHLVLQGTPKEGHYQIQTLSLTTPEVKLSGKGAWKNSEGENVTEFDVKLDATKFDALS
FT                   SILDMDPGLKDAPVEIDANISWQGAPYAFSLESLNGKINFELGKGHLSEVSDKGARIFS
FT                   LFSLDSLLRKLSLDFSDVFGKGLYFNSFTGTLEIDNGVIKTRDTEMDAVAGNMKVRGYT
FT                   DLVTESLNYDIRFVPQLASSVPTVVLLTTGGWTLGIGAFALTKVLEPVIEVITELRFRL
FT                   TGTMSEPKLEELERKSKEIEIPESALPRTKEGQPDNKQPAKKGAETQGVEKQEEKSQGA
FT                   DSRESSAPAKINESGVEILAPKVIEMPDFRETNSYPPASNEDKISPPKEAIDADQPVTV
FT                   PKQSRYSPKPAVYRVAA"
     MPRQFCPFKF SRFCWQILAI ILVLFALAVS LFRGLLPQLA EVRQELVKYV EEQYQVQVNV        60
     GELNAEWQAF GPALTVKNLV LPPQERLPFT LIIRDVHVKL DFWESLMTTS PQIENVIFEG       120
     VQVGLDLDKL NQAGPSTVSA ETDTDWLYRL LLEQLEHFSI TEASLQLLSK SHDFRPIYVK       180
     DLRWQNRNNK HQGQGKLYLD EKASEVEQLS LSLEIDGNGF RPDTLKGQVY LAASSLDLGE       240
     WASRQANPYD EKSKLPLEGV VNLQAWLSLG NRSIESGLIQ FEPSWLEWQL NEEVQHFEIK       300
     GGQFEWLPID KGWQLSSRSL EFETNDRPWS ELNFVAQQRG EQLSAYLNRL DTSTLLPLLP       360
     LAPKVDLLAL KTWQSINPQG YLDNIKFSLN GDLGPQVSLD INQLQWRNFE SIPGSKALDL       420
     QVAWYDDSLY FNAPEQAYTL DFSTAFKAPI VLNGAAFDAR FNTQYSELTL PRLQFSNKDI       480
     GIDASVKMGF AGDTHLALLA DVKINDVVDV GNYFPLHGMD AGLVDYLEAG LVAGNTQDAR       540
     VVWHGPLNQY PYKDHSGIFQ AAFTLSDAEF KFQPDWPAVT SLELSALFEN ARMDLTIDSG       600
     DLLDVVVDGA RISIPELGAR SLLEIDAELA TQGVAATEVI QASPLAESVG STLAVVQVQG       660
     DVTATLDLSI PLYDGEEEQI RGLVNLDNTP IYITEPGVQL DGVTGQVSFV NEVVKGKDIS       720
     ALLYQQPVSL TFDTEQVRDN YGLNLDLKGV WQLDELPAEL DNPLMDFYSG EVNWNGAMTL       780
     IFDQTGYRIQ AQVNSDLLGT ELTLPPPFSK ATDEKRRLSA ELIGDNKQSS LGIKLGNQME       840
     FWGGFDLESG DQLSHFDLLL GRLFKPGDQL KRDQGHLQLD IAQTEFSPWL PIITSFTSAA       900
     TSEINLAPIV PEPQSVPETE AVSAPELNPG EKASVQQEQT RGFFPPLISI DADIGDLNLM       960
     GQTLSELTMT AAPFEELWRF EAQSKEFDGR IDFYPDWSTQ GLKMVAKKFH IAPAVKEEAK      1020
     ADFKSGTVLN NLPPLALDVD DFRLYGKPLG HLVLQGTPKE GHYQIQTLSL TTPEVKLSGK      1080
     GAWKNSEGEN VTEFDVKLDA TKFDALSSIL DMDPGLKDAP VEIDANISWQ GAPYAFSLES      1140
     LNGKINFELG KGHLSEVSDK GARIFSLFSL DSLLRKLSLD FSDVFGKGLY FNSFTGTLEI      1200
     DNGVIKTRDT EMDAVAGNMK VRGYTDLVTE SLNYDIRFVP QLASSVPTVV LLTTGGWTLG      1260
     IGAFALTKVL EPVIEVITEL RFRLTGTMSE PKLEELERKS KEIEIPESAL PRTKEGQPDN      1320
     KQPAKKGAET QGVEKQEEKS QGADSRESSA PAKINESGVE ILAPKVIEMP DFRETNSYPP      1380
     ASNEDKISPP KEAIDADQPV TVPKQSRYSP KPAVYRVAA                             1419
//

If you have problems or comments...

PBIL Back to PBIL home page