(data stored in ACNUC7421 zone)

EMBL: CP000821.PE565

CP000821.PE565       Location/Qualifiers
FT   CDS             689688..691109
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0566"
FT                   /product="outer membrane efflux protein"
FT                   /note="KEGG: slo:Shew_0411 outer membrane efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35178"
FT                   /db_xref="GOA:A8FQQ5"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQQ5"
FT                   /protein_id="ABV35178.1"
FT                   /translation="MKFSHIALLSLAALGPFTAGAKEMGFSQAWQQLLTVSDKLQAGAQ
FT                   EVNRAEAEHEAGKDLYLPSISLNGSYTRLEKPIELDLNDLNPLASMDPSTLPPSIGGAL
FT                   AGIPSSMFVTQFTEQDIFRSSLQAMWPIYTGGKISAAQGIHAAHVIEKEQQLQLSTRDL
FT                   FIQLVDRYYGVAVTQSLAQTRGELVSSLEEHASHAQKLEEQGQIAKVERLNAQVALENA
FT                   KVNFASAVRQAEMAVIALSRMLHEHEVDTTSALFMLADAPSLPHLSQLTLVQHPALKLL
FT                   EAKEEQANGLIDLEKGKYHPTVFLYGNYTLYEDDSLFSKMEPDWMLGVGVKVPLLSRDG
FT                   RSGKVQAAKSALLQARYTKAQTRQDLSLLLDQSYRQLLQAQEEVLSLETSLSLAQENKR
FT                   LRDLAFRQGLSTSIEKVDAELKLTAVETQQLGAKYRYIQAYARLMAISGQLEEFLGRSV
FT                   SHHTNVAMQESNNAG"
     MKFSHIALLS LAALGPFTAG AKEMGFSQAW QQLLTVSDKL QAGAQEVNRA EAEHEAGKDL        60
     YLPSISLNGS YTRLEKPIEL DLNDLNPLAS MDPSTLPPSI GGALAGIPSS MFVTQFTEQD       120
     IFRSSLQAMW PIYTGGKISA AQGIHAAHVI EKEQQLQLST RDLFIQLVDR YYGVAVTQSL       180
     AQTRGELVSS LEEHASHAQK LEEQGQIAKV ERLNAQVALE NAKVNFASAV RQAEMAVIAL       240
     SRMLHEHEVD TTSALFMLAD APSLPHLSQL TLVQHPALKL LEAKEEQANG LIDLEKGKYH       300
     PTVFLYGNYT LYEDDSLFSK MEPDWMLGVG VKVPLLSRDG RSGKVQAAKS ALLQARYTKA       360
     QTRQDLSLLL DQSYRQLLQA QEEVLSLETS LSLAQENKRL RDLAFRQGLS TSIEKVDAEL       420
     KLTAVETQQL GAKYRYIQAY ARLMAISGQL EEFLGRSVSH HTNVAMQESN NAG              473
//

If you have problems or comments...

PBIL Back to PBIL home page