(data stored in ACNUC7421 zone)

EMBL: CP000821.PE566

CP000821.PE566       Location/Qualifiers
FT   CDS             691099..692070
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0567"
FT                   /product="secretion protein HlyD family protein"
FT                   /note="KEGG: slo:Shew_0412 secretion protein HlyD family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35179"
FT                   /db_xref="GOA:A8FQQ6"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQQ6"
FT                   /protein_id="ABV35179.1"
FT                   /translation="MQANRIIGVVAIIGLVGALGYGLKLAYTPQDERIQGQIEAREYNI
FT                   SSKVPGRVEQVLVRRGDKVEAGDLLFAIDSPELSAKLMQAEGGRDAAQAMQLEADTGAR
FT                   KQQVMASKEQWLKAKAAATLAKTTYDRVEVLFVEGVLARQKRDEAFTQWQAAKYTEQAA
FT                   LAMYEMANEGAREETKAAAAGNARMAEGAVNEVSAILADSQMRAPKSGEISEVLLQPGE
FT                   LAPSGFPVVSIIDMDDAWAVFQVREDQLKEFKMGQKHLIFIPALGGEYEFSVTHISVMG
FT                   EFATWRATESGHDFDMRTFEMELRPVKTIPDLRVGMTTLMAQ"
     MQANRIIGVV AIIGLVGALG YGLKLAYTPQ DERIQGQIEA REYNISSKVP GRVEQVLVRR        60
     GDKVEAGDLL FAIDSPELSA KLMQAEGGRD AAQAMQLEAD TGARKQQVMA SKEQWLKAKA       120
     AATLAKTTYD RVEVLFVEGV LARQKRDEAF TQWQAAKYTE QAALAMYEMA NEGAREETKA       180
     AAAGNARMAE GAVNEVSAIL ADSQMRAPKS GEISEVLLQP GELAPSGFPV VSIIDMDDAW       240
     AVFQVREDQL KEFKMGQKHL IFIPALGGEY EFSVTHISVM GEFATWRATE SGHDFDMRTF       300
     EMELRPVKTI PDLRVGMTTL MAQ                                               323
//

If you have problems or comments...

PBIL Back to PBIL home page