(data stored in ACNUC7421 zone)

EMBL: CP000821.PE569

CP000821.PE569       Location/Qualifiers
FT   CDS             complement(694715..697270)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0570"
FT                   /product="Ig domain protein, group 1 domain protein"
FT                   /note="KEGG: sbl:Sbal_3807 Ig domain protein, group 1
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35182"
FT                   /db_xref="InterPro:IPR003344"
FT                   /db_xref="InterPro:IPR008964"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQQ9"
FT                   /protein_id="ABV35182.1"
FT                   /translation="MRLIKTAFALPLSFLLLSSLGGCNGASDDSGGENTGEYALSLSYK
FT                   TVVDGKCADATNDLSFANNASICAVAKLTQGGSNSNGGLISFSATLGELSPATKLTDTQ
FT                   GIAEVILGNAQASLGAGTLTAQFDTKAAENNILAVNRNYEFVDDGIPDEDTPKISASII
FT                   NGAATVTQFKVDETVQLQAQFLDSSSQGIAQQIVTFSAGSTTLNPNTALTNEQGIAQVS
FT                   YTPSENELGAASLNVSLSYKDQGYQENSLYEVLPANAIGDDGVLKLGHFDDNNNFIEDE
FT                   LATTLTPVDGKYRISAGGSFGITATLVSVADDGTITRVQTPSSISFGSDCVTSNNASLD
FT                   TPVTTLSGSAGSTFQDTSCSGNSERDDQIVATTQAGNQTLTANLPFTLERQTLASLSFL
FT                   SAEPKNIRIKGAGGTGSTESSLVTFKVTSSNGQPAAQQAVKFTLDTVVGGLSFSNGAAT
FT                   DESLTNSQGIASIRVLAGTMPTPVRVLASATDTDTNETITSQSEQLTVNTGLPQQLGFS
FT                   ISTSMFNPEAGDFNGEKVTLTAYASDTFGNPAPDDTTINFTSEGGQIVPSCLTVNGSCS
FT                   VEWTSANPRVPDHRITVLAYALGHETFFDTNGNNVFDDKDVTVDAEGKPVVDKACLNSD
FT                   GQAIHCSGNGMDIEAYLPSGFSDLGDAFRDDDESFSYTPGEKYFNTTSSGEYQIPDGKF
FT                   NGPQCQSTIVGCEPNTYIRKALVMTMSGSSAGFTIWQGNNLIRDDFGLATGSIVPLTAI
FT                   AAGESSSFTVQFYDSAYQIMPASTQVAVEASAGELIFDAFEVANTTRRGGTTTGFIITN
FT                   DIDPGSTGEPAKLSSVSINLTTPKNFKSGAGLSITLSGT"
     MRLIKTAFAL PLSFLLLSSL GGCNGASDDS GGENTGEYAL SLSYKTVVDG KCADATNDLS        60
     FANNASICAV AKLTQGGSNS NGGLISFSAT LGELSPATKL TDTQGIAEVI LGNAQASLGA       120
     GTLTAQFDTK AAENNILAVN RNYEFVDDGI PDEDTPKISA SIINGAATVT QFKVDETVQL       180
     QAQFLDSSSQ GIAQQIVTFS AGSTTLNPNT ALTNEQGIAQ VSYTPSENEL GAASLNVSLS       240
     YKDQGYQENS LYEVLPANAI GDDGVLKLGH FDDNNNFIED ELATTLTPVD GKYRISAGGS       300
     FGITATLVSV ADDGTITRVQ TPSSISFGSD CVTSNNASLD TPVTTLSGSA GSTFQDTSCS       360
     GNSERDDQIV ATTQAGNQTL TANLPFTLER QTLASLSFLS AEPKNIRIKG AGGTGSTESS       420
     LVTFKVTSSN GQPAAQQAVK FTLDTVVGGL SFSNGAATDE SLTNSQGIAS IRVLAGTMPT       480
     PVRVLASATD TDTNETITSQ SEQLTVNTGL PQQLGFSIST SMFNPEAGDF NGEKVTLTAY       540
     ASDTFGNPAP DDTTINFTSE GGQIVPSCLT VNGSCSVEWT SANPRVPDHR ITVLAYALGH       600
     ETFFDTNGNN VFDDKDVTVD AEGKPVVDKA CLNSDGQAIH CSGNGMDIEA YLPSGFSDLG       660
     DAFRDDDESF SYTPGEKYFN TTSSGEYQIP DGKFNGPQCQ STIVGCEPNT YIRKALVMTM       720
     SGSSAGFTIW QGNNLIRDDF GLATGSIVPL TAIAAGESSS FTVQFYDSAY QIMPASTQVA       780
     VEASAGELIF DAFEVANTTR RGGTTTGFII TNDIDPGSTG EPAKLSSVSI NLTTPKNFKS       840
     GAGLSITLSG T                                                            851
//

If you have problems or comments...

PBIL Back to PBIL home page