(data stored in ACNUC7421 zone)

EMBL: CP000821.PE57

CP000821.PE57        Location/Qualifiers
FT   CDS             complement(68291..69085)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0057"
FT                   /product="flagellin domain protein"
FT                   /note="KEGG: shw:Sputw3181_0483 flagellin domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34670"
FT                   /db_xref="GOA:A8FP97"
FT                   /db_xref="InterPro:IPR001029"
FT                   /db_xref="InterPro:IPR001492"
FT                   /db_xref="UniProtKB/TrEMBL:A8FP97"
FT                   /protein_id="ABV34670.1"
FT                   /translation="MLSVQTNNASNIAQNSVNKSNDLLSNAMERLSTGLRINSAADDAA
FT                   GLQIATRMNANVVGMETANRNVSDATSMLQTADGALDELTTIANRQKELATQAANGVNS
FT                   TEDLAALDAEFQELSKEVTRIVTDTEYSGNKLFAELEAGVTFQIGASSGETLDVTTNAI
FT                   TAVAGDLKAGANAAIDLVDTFIDEVGAERSTLGANINRLGHTASNLTNVTENTKAAAGR
FT                   IMDTDFAVETANMTKNQLLVQAGTNILSSANQNTGLVMSLLG"
     MLSVQTNNAS NIAQNSVNKS NDLLSNAMER LSTGLRINSA ADDAAGLQIA TRMNANVVGM        60
     ETANRNVSDA TSMLQTADGA LDELTTIANR QKELATQAAN GVNSTEDLAA LDAEFQELSK       120
     EVTRIVTDTE YSGNKLFAEL EAGVTFQIGA SSGETLDVTT NAITAVAGDL KAGANAAIDL       180
     VDTFIDEVGA ERSTLGANIN RLGHTASNLT NVTENTKAAA GRIMDTDFAV ETANMTKNQL       240
     LVQAGTNILS SANQNTGLVM SLLG                                              264
//

If you have problems or comments...

PBIL Back to PBIL home page