(data stored in ACNUC7421 zone)

EMBL: CP000821.PE570

CP000821.PE570       Location/Qualifiers
FT   CDS             complement(697353..697892)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0571"
FT                   /product="protein of unknown function DUF615"
FT                   /note="KEGG: slo:Shew_0415 protein of unknown function
FT                   DUF615"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35183"
FT                   /db_xref="InterPro:IPR006839"
FT                   /db_xref="InterPro:IPR023153"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQR0"
FT                   /protein_id="ABV35183.1"
FT                   /translation="MKIVGDSEHFKQPFDHDEEYVSRAEAKREIAVYQELGIKLVALSK
FT                   SQIKKLNLDELLFDNVMKTKTIKINTEAYRRQLQFIGKIMRNVDIEALQLDIKNVLNQN
FT                   SNESAKQNVAEKLKEQLLSEGDAAVQDLLEKHPQLERQKLRQLIRQSIKELAKKPDEAS
FT                   KSSIELVKYLRNEISE"
     MKIVGDSEHF KQPFDHDEEY VSRAEAKREI AVYQELGIKL VALSKSQIKK LNLDELLFDN        60
     VMKTKTIKIN TEAYRRQLQF IGKIMRNVDI EALQLDIKNV LNQNSNESAK QNVAEKLKEQ       120
     LLSEGDAAVQ DLLEKHPQLE RQKLRQLIRQ SIKELAKKPD EASKSSIELV KYLRNEISE        179
//

If you have problems or comments...

PBIL Back to PBIL home page