(data stored in ACNUC7421 zone)

EMBL: CP000821.PE574

CP000821.PE574       Location/Qualifiers
FT   CDS             700791..701840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0575"
FT                   /product="arsenical-resistance protein"
FT                   /note="KEGG: slo:Shew_0418 arsenical-resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35187"
FT                   /db_xref="GOA:A8FQR4"
FT                   /db_xref="InterPro:IPR002657"
FT                   /db_xref="InterPro:IPR004706"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQR4"
FT                   /protein_id="ABV35187.1"
FT                   /translation="MGLFERYLSVWVGLAIVLGVILGNLMPDVFALVAAVEYAHVNLVI
FT                   AVLIWVMIYPMMVQIDFAAVKDVRKSPKGLVLTLVVNWLIKPFTMALLGWLFFKVLFVE
FT                   WVDPQTATEYIAGMILLGVAPCTAMVFVWSQLTKGDPNYTLVQVSVNDLIMVVAFAPIC
FT                   AFLLGVSDIQVPWETLLSSVFLYVVLPLVAGVLTRKKLESDGDPASLARFVSNLKPWSI
FT                   VGLLATVVLLFGFQAETILNEPQNILLIAIPLLIQTYGIFFIAYYAAKKLKLSHKVAAP
FT                   ACMIATSNFFELAVAVAISLFGLHSGAALATVVGVLVEVPVMLSLVAFVNRNRKQFEDD
FT                   RDEHQAASE"
     MGLFERYLSV WVGLAIVLGV ILGNLMPDVF ALVAAVEYAH VNLVIAVLIW VMIYPMMVQI        60
     DFAAVKDVRK SPKGLVLTLV VNWLIKPFTM ALLGWLFFKV LFVEWVDPQT ATEYIAGMIL       120
     LGVAPCTAMV FVWSQLTKGD PNYTLVQVSV NDLIMVVAFA PICAFLLGVS DIQVPWETLL       180
     SSVFLYVVLP LVAGVLTRKK LESDGDPASL ARFVSNLKPW SIVGLLATVV LLFGFQAETI       240
     LNEPQNILLI AIPLLIQTYG IFFIAYYAAK KLKLSHKVAA PACMIATSNF FELAVAVAIS       300
     LFGLHSGAAL ATVVGVLVEV PVMLSLVAFV NRNRKQFEDD RDEHQAASE                   349
//

If you have problems or comments...

PBIL Back to PBIL home page