(data stored in ACNUC7421 zone)

EMBL: CP000821.PE578

CP000821.PE578       Location/Qualifiers
FT   CDS             complement(705321..706250)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0579"
FT                   /product="putative LysR-like regular protein"
FT                   /note="KEGG: vpa:VP2406 putative LysR-like regular protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35191"
FT                   /db_xref="GOA:A8FQR8"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQR8"
FT                   /protein_id="ABV35191.1"
FT                   /translation="MTNEINWKSTDLNLLVTFSYLYRYRSVSIAADKSHVSQSAMSHSL
FT                   ARLRILFDDQLFERKGHHMEPSEYAHHIAPIVGQLLDDISHRLLAKEQFTPLSYSGECR
FT                   IGLTDYAEFIFAPSLYDAIQASAPKSQVSFINVNRHNYVNIADQDKLDVVIGSMPQPHS
FT                   DFDSKFLYTEKHVCLCDSQLFSNNQTLTVAEFAAVEQALVSPDGTLVTQVDKRLADLGL
FT                   TRKVSVASRNFLTIRSLLKKRKLIAIVPELMAKAQGFDDQLTALTPPVDIADFEISLLW
FT                   KSKLTNNDKNSWLRSVVQNVLSNAKSQS"
     MTNEINWKST DLNLLVTFSY LYRYRSVSIA ADKSHVSQSA MSHSLARLRI LFDDQLFERK        60
     GHHMEPSEYA HHIAPIVGQL LDDISHRLLA KEQFTPLSYS GECRIGLTDY AEFIFAPSLY       120
     DAIQASAPKS QVSFINVNRH NYVNIADQDK LDVVIGSMPQ PHSDFDSKFL YTEKHVCLCD       180
     SQLFSNNQTL TVAEFAAVEQ ALVSPDGTLV TQVDKRLADL GLTRKVSVAS RNFLTIRSLL       240
     KKRKLIAIVP ELMAKAQGFD DQLTALTPPV DIADFEISLL WKSKLTNNDK NSWLRSVVQN       300
     VLSNAKSQS                                                               309
//

If you have problems or comments...

PBIL Back to PBIL home page