(data stored in ACNUC7421 zone)

EMBL: CP000821.PE579

CP000821.PE579       Location/Qualifiers
FT   CDS             706356..707492
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0580"
FT                   /product="chromate resistance protein-related protein"
FT                   /note="KEGG: vpa:VP2407 chromate resistance protein-related
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35192"
FT                   /db_xref="GOA:A8FQR9"
FT                   /db_xref="InterPro:IPR003370"
FT                   /db_xref="InterPro:IPR014047"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQR9"
FT                   /protein_id="ABV35192.1"
FT                   /translation="MLSIFKAFFALGWISFGGPAAHIGYFRITFVEKLKWLDDKEYGQI
FT                   VALSQFLPGPGSSQVGFALGYKRGGLGGACLAFIGFTLPSVLIMLVLAVLSSQLTTTPM
FT                   FQSIVHGLKLLAVIVVADATIGMYKNFCRQKLTIGLCIATAVSLLVFPGIATQMLVLAI
FT                   AAIIGAKMLANQQANIDQSFRPSVAPLVLFVLLLIGLPFVAQQLPMLALFSDFYQAGSL
FT                   VFGGGHVVLPLLQNIVGDQISQDTFLTGYAVAQAVPGPMFTFATFIGYELLPDAPLFGS
FT                   LIATLGVFLPGFLLLLGVLRNWQQLASNKLVSGAINGVNAAVVGLLVAALYQPVFSSAV
FT                   VDGLDFALILVGFFLLKQLKLPIVAMVVFYIITGVILL"
     MLSIFKAFFA LGWISFGGPA AHIGYFRITF VEKLKWLDDK EYGQIVALSQ FLPGPGSSQV        60
     GFALGYKRGG LGGACLAFIG FTLPSVLIML VLAVLSSQLT TTPMFQSIVH GLKLLAVIVV       120
     ADATIGMYKN FCRQKLTIGL CIATAVSLLV FPGIATQMLV LAIAAIIGAK MLANQQANID       180
     QSFRPSVAPL VLFVLLLIGL PFVAQQLPML ALFSDFYQAG SLVFGGGHVV LPLLQNIVGD       240
     QISQDTFLTG YAVAQAVPGP MFTFATFIGY ELLPDAPLFG SLIATLGVFL PGFLLLLGVL       300
     RNWQQLASNK LVSGAINGVN AAVVGLLVAA LYQPVFSSAV VDGLDFALIL VGFFLLKQLK       360
     LPIVAMVVFY IITGVILL                                                     378
//

If you have problems or comments...

PBIL Back to PBIL home page