(data stored in ACNUC7421 zone)

EMBL: CP000821.PE58

CP000821.PE58        Location/Qualifiers
FT   CDS             complement(69675..70700)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0058"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: spc:Sputcn32_3457 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34671"
FT                   /db_xref="UniProtKB/TrEMBL:A8FP98"
FT                   /protein_id="ABV34671.1"
FT                   /translation="MVNGISDSLNVQQRSQPLVAATNDRHQSKAPKPAQLTAIPSHRLE
FT                   TYARWARVTQGQHKISAFQVAEQGLKQIFHLLKQLKRLAQSAISLSGESRNAQIKAATS
FT                   LQQRLSQLRVEYQNRPLLDHQLNLISKKRPPAPRQFILKSIELAQPKPRDERIQIQSDK
FT                   DSISIFLPANASKAALTGHLSEAMHNLEITIPAPHSETTVFNCNDERWQKIKAGIMMTG
FT                   KGQRLPAGEARTIKVDEILSWQDPREWRLGSNEDLKQTVVKIHKSLFKLEQQLRELTQT
FT                   ADKIQRQLHKANKENDFDDELKKTLNSLERLMQATPFTLQMTSVMAQANVTRSQVSSLL
FT                   L"
     MVNGISDSLN VQQRSQPLVA ATNDRHQSKA PKPAQLTAIP SHRLETYARW ARVTQGQHKI        60
     SAFQVAEQGL KQIFHLLKQL KRLAQSAISL SGESRNAQIK AATSLQQRLS QLRVEYQNRP       120
     LLDHQLNLIS KKRPPAPRQF ILKSIELAQP KPRDERIQIQ SDKDSISIFL PANASKAALT       180
     GHLSEAMHNL EITIPAPHSE TTVFNCNDER WQKIKAGIMM TGKGQRLPAG EARTIKVDEI       240
     LSWQDPREWR LGSNEDLKQT VVKIHKSLFK LEQQLRELTQ TADKIQRQLH KANKENDFDD       300
     ELKKTLNSLE RLMQATPFTL QMTSVMAQAN VTRSQVSSLL L                           341
//

If you have problems or comments...

PBIL Back to PBIL home page