(data stored in ACNUC7421 zone)

EMBL: CP000821.PE580

CP000821.PE580       Location/Qualifiers
FT   CDS             complement(707643..709520)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0581"
FT                   /product="GGDEF domain"
FT                   /note="KEGG: sdn:Sden_2587 GGDEF domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35193"
FT                   /db_xref="GOA:A8FQS0"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQS0"
FT                   /protein_id="ABV35193.1"
FT                   /translation="MFFLLMKKWLTWLGCVLFVFSTNGFASDALTELERAAKAVSPADG
FT                   IELLNKFDLKNSKLEAEQQAKVYYLYGQLYEKTRQLDQSIASYDKGIELVKYLPITDVL
FT                   IDSHLERSFALYLQSNDPAAYCVDRKQALVYARLHHNSELLAKTLTQNAFCFNEPKSIH
FT                   KGIALLDEAMAIVDKNNLNVNRKALIYNATGSLYRQVGLHRRGYDSFEKAYQTWQSIND
FT                   IEDMFNMQYNMLSEAISLGHWDKASQSVEAQFSLAAMSTGDNDMLFFSHLNAGRVALRT
FT                   YDYDKAVLHLEKAVSLNHTTQEKYFISSNYLYLGLAYMRSGEAEKAADMARTFKQDDSF
FT                   AANQKAMLLQADAIIALDEHDPVNALNKLFQVIDIEREINQSVIDNEVISLSLDHNSAL
FT                   AEFENELLGNRLAINELSLASVKDKERINELKLSLFFIIVTVLFCIVLFLLISRRTLKV
FT                   RAQTDFLTGLANRGHTFKKGQKIIEKTIKKQQPASVIMFDIDDFKSINDRYGHHIGDLA
FT                   IKSVSKRTRRWLKKHDLVGRIGGEEFLIVLENTSQTEAYDIADRLRHNIEEQFFQFDDV
FT                   TVELTISLGVAALNEHTTTLIGLMKQADDALYRAKFSGKNKVYLAAECA"
     MFFLLMKKWL TWLGCVLFVF STNGFASDAL TELERAAKAV SPADGIELLN KFDLKNSKLE        60
     AEQQAKVYYL YGQLYEKTRQ LDQSIASYDK GIELVKYLPI TDVLIDSHLE RSFALYLQSN       120
     DPAAYCVDRK QALVYARLHH NSELLAKTLT QNAFCFNEPK SIHKGIALLD EAMAIVDKNN       180
     LNVNRKALIY NATGSLYRQV GLHRRGYDSF EKAYQTWQSI NDIEDMFNMQ YNMLSEAISL       240
     GHWDKASQSV EAQFSLAAMS TGDNDMLFFS HLNAGRVALR TYDYDKAVLH LEKAVSLNHT       300
     TQEKYFISSN YLYLGLAYMR SGEAEKAADM ARTFKQDDSF AANQKAMLLQ ADAIIALDEH       360
     DPVNALNKLF QVIDIEREIN QSVIDNEVIS LSLDHNSALA EFENELLGNR LAINELSLAS       420
     VKDKERINEL KLSLFFIIVT VLFCIVLFLL ISRRTLKVRA QTDFLTGLAN RGHTFKKGQK       480
     IIEKTIKKQQ PASVIMFDID DFKSINDRYG HHIGDLAIKS VSKRTRRWLK KHDLVGRIGG       540
     EEFLIVLENT SQTEAYDIAD RLRHNIEEQF FQFDDVTVEL TISLGVAALN EHTTTLIGLM       600
     KQADDALYRA KFSGKNKVYL AAECA                                             625
//

If you have problems or comments...

PBIL Back to PBIL home page