(data stored in ACNUC7421 zone)

EMBL: CP000821.PE582

CP000821.PE582       Location/Qualifiers
FT   CDS             711267..711389
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0583"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: shm:Shewmr7_3567 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35195"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQS2"
FT                   /protein_id="ABV35195.1"
FT                   /translation="MSKGKSIRKEGKKQPQKTAKEKRMAKHAKKESRGLLDNVK"
     MSKGKSIRKE GKKQPQKTAK EKRMAKHAKK ESRGLLDNVK                              40
//

If you have problems or comments...

PBIL Back to PBIL home page