(data stored in ACNUC7421 zone)

EMBL: CP000821.PE583

CP000821.PE583       Location/Qualifiers
FT   CDS             712221..713600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0584"
FT                   /product="amino acid carrier protein"
FT                   /note="KEGG: slo:Shew_0424 amino acid carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35196"
FT                   /db_xref="GOA:A8FQS3"
FT                   /db_xref="InterPro:IPR001463"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQS3"
FT                   /protein_id="ABV35196.1"
FT                   /translation="MEGITEFVSMINGFVWGTPMLVMILGVGLFLSVGLKLMPILKLGT
FT                   GFKLLWSGRIPDKDKTMEGEISPFNALMTSLSATIGTGNIAGVATAIFIGGPGALFWMW
FT                   CTALVGMATKFAEAVLAVKYREVDDNGDHIGGPMYYIKNGLGSKWAWLGTAFALFGSFA
FT                   GFGIGNTVQSNSVADALSSNFGVPTWATGVVLMMLVGAVLMGGIKRIADVAGKLVPLMT
FT                   LFYIAAGLAVLAVNAAAIPDAIVMIVHSAFNPVAAQGGFAGAAVWAAIRFGVARGVFSN
FT                   EAGLGSAPIAHASAQTNNPVAQGLVAMLGTFIDTLIVCSITGLAIIVSGAWTSGENGAA
FT                   LTSLAFSTAIPMGNYIVAVALSVFAFTTILGWSVYSEKCVQYLFGVKAVKPFRVLWILV
FT                   VPLGAVSSLDFIWLLADTLNAMMAIPNLIALALLSPVVFSLTREYFIKKREDEAQAKIA
FT                   S"
     MEGITEFVSM INGFVWGTPM LVMILGVGLF LSVGLKLMPI LKLGTGFKLL WSGRIPDKDK        60
     TMEGEISPFN ALMTSLSATI GTGNIAGVAT AIFIGGPGAL FWMWCTALVG MATKFAEAVL       120
     AVKYREVDDN GDHIGGPMYY IKNGLGSKWA WLGTAFALFG SFAGFGIGNT VQSNSVADAL       180
     SSNFGVPTWA TGVVLMMLVG AVLMGGIKRI ADVAGKLVPL MTLFYIAAGL AVLAVNAAAI       240
     PDAIVMIVHS AFNPVAAQGG FAGAAVWAAI RFGVARGVFS NEAGLGSAPI AHASAQTNNP       300
     VAQGLVAMLG TFIDTLIVCS ITGLAIIVSG AWTSGENGAA LTSLAFSTAI PMGNYIVAVA       360
     LSVFAFTTIL GWSVYSEKCV QYLFGVKAVK PFRVLWILVV PLGAVSSLDF IWLLADTLNA       420
     MMAIPNLIAL ALLSPVVFSL TREYFIKKRE DEAQAKIAS                              459
//

If you have problems or comments...

PBIL Back to PBIL home page