(data stored in ACNUC7421 zone)

EMBL: CP000821.PE585

CP000821.PE585       Location/Qualifiers
FT   CDS             complement(714968..715951)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0586"
FT                   /product="ABC transporter-related protein"
FT                   /note="KEGG: slo:Shew_0426 ABC transporter-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35198"
FT                   /db_xref="GOA:A8FQS5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR025302"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQS5"
FT                   /protein_id="ABV35198.1"
FT                   /translation="MNNKGSSNELAIDARGLTKHFGSLAAVSDMNLSVEKGHIYGFLGP
FT                   NGCGKSTSIRMLTGLLTPTAGSIEVLGMSIPKQAEALRLRIGYMTQKFSLYDDLTVKEN
FT                   LEFIAQIYCLTPNESKRKIGELLSTYKLIKQAKQYAGTLSGGQKQRLSLACSCLNDPEL
FT                   LFLDEPTSAVDPQNRRDFWEQLFDLSESGTSILVTTHYMDEAERCHGLAIMEQGYIRAD
FT                   GSPNELMRQMGAHVIEVSHPNLRQLKSELMLNREIKSAAQLGARLRVLVDNKISDPLGW
FT                   LRQIRPELALNEIREVPPNLEDVFVTVTGQDRDRDSTREPQTSEAN"
     MNNKGSSNEL AIDARGLTKH FGSLAAVSDM NLSVEKGHIY GFLGPNGCGK STSIRMLTGL        60
     LTPTAGSIEV LGMSIPKQAE ALRLRIGYMT QKFSLYDDLT VKENLEFIAQ IYCLTPNESK       120
     RKIGELLSTY KLIKQAKQYA GTLSGGQKQR LSLACSCLND PELLFLDEPT SAVDPQNRRD       180
     FWEQLFDLSE SGTSILVTTH YMDEAERCHG LAIMEQGYIR ADGSPNELMR QMGAHVIEVS       240
     HPNLRQLKSE LMLNREIKSA AQLGARLRVL VDNKISDPLG WLRQIRPELA LNEIREVPPN       300
     LEDVFVTVTG QDRDRDSTRE PQTSEAN                                           327
//

If you have problems or comments...

PBIL Back to PBIL home page