(data stored in ACNUC7421 zone)

EMBL: CP000821.PE586

CP000821.PE586       Location/Qualifiers
FT   CDS             complement(715948..716892)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0587"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: slo:Shew_0427 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35199"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQS6"
FT                   /protein_id="ABV35199.1"
FT                   /translation="MRPFLSIIFILSLAACQGDVTNQALGTLERDRVLLRATASEIITD
FT                   LPIAEGSMVKKGELLLQFDNNKQLATVAMANAEVQKSQAYLLRLTNGERPEDIASAQAN
FT                   VARTQAALIEAKQSYKRTSSLLKQNLASQAAQDRARANRDQSQAEFNAANENLSKLIAG
FT                   VREEDINQAKAALDAAKAYLSLEKKTLDDLSVIATRDGNLDSLPFNLGERVPPNAVIVA
FT                   IQADNAPYARVYIPETHVAKLTIGQTLTVHVDGVEQVFQGKLRWLSTQPAFTPYYALNQ
FT                   EDRARLVFLAEIDLGSDADRLPTGIPSQVDLPL"
     MRPFLSIIFI LSLAACQGDV TNQALGTLER DRVLLRATAS EIITDLPIAE GSMVKKGELL        60
     LQFDNNKQLA TVAMANAEVQ KSQAYLLRLT NGERPEDIAS AQANVARTQA ALIEAKQSYK       120
     RTSSLLKQNL ASQAAQDRAR ANRDQSQAEF NAANENLSKL IAGVREEDIN QAKAALDAAK       180
     AYLSLEKKTL DDLSVIATRD GNLDSLPFNL GERVPPNAVI VAIQADNAPY ARVYIPETHV       240
     AKLTIGQTLT VHVDGVEQVF QGKLRWLSTQ PAFTPYYALN QEDRARLVFL AEIDLGSDAD       300
     RLPTGIPSQV DLPL                                                         314
//

If you have problems or comments...

PBIL Back to PBIL home page