(data stored in ACNUC7421 zone)

EMBL: CP000821.PE587

CP000821.PE587       Location/Qualifiers
FT   CDS             717378..718286
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0588"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35200"
FT                   /db_xref="GOA:A8FQS7"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQS7"
FT                   /protein_id="ABV35200.1"
FT                   /translation="MDIPVWQYVVSMTGYIVFLLVLVEGMRRAPRMTAAFWLLSLLTAP
FT                   LWADNLDGWFRWVKTVSVLIPTAIVVGGARIAWLYHDNPNKFLAFFRGDWVLKVLYMVL
FT                   FLNIAEATAKDFATANYFNAICGVILCITIPFPRYKNGKRLYWVIGRDKPNDLLFYSTA
FT                   AWNFLYTTWNLAFVFGENPGFFASSFCILMAAELYPIIKGRPELYIIARVYTLAFHILV
FT                   RANGDIFTPVMDSSSWASDSVVYYWGAINLAMHIPFVIWYFKTKNKSETNEPPFGEKSP
FT                   PPLISDYSDTKVNDESKLTTA"
     MDIPVWQYVV SMTGYIVFLL VLVEGMRRAP RMTAAFWLLS LLTAPLWADN LDGWFRWVKT        60
     VSVLIPTAIV VGGARIAWLY HDNPNKFLAF FRGDWVLKVL YMVLFLNIAE ATAKDFATAN       120
     YFNAICGVIL CITIPFPRYK NGKRLYWVIG RDKPNDLLFY STAAWNFLYT TWNLAFVFGE       180
     NPGFFASSFC ILMAAELYPI IKGRPELYII ARVYTLAFHI LVRANGDIFT PVMDSSSWAS       240
     DSVVYYWGAI NLAMHIPFVI WYFKTKNKSE TNEPPFGEKS PPPLISDYSD TKVNDESKLT       300
     TA                                                                      302
//

If you have problems or comments...

PBIL Back to PBIL home page