(data stored in ACNUC7421 zone)

EMBL: CP000821.PE589

CP000821.PE589       Location/Qualifiers
FT   CDS             719671..720528
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0590"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: vfi:VFA0898 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35202"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQS9"
FT                   /protein_id="ABV35202.1"
FT                   /translation="MKKRILSIAILASMTSGLTYAADDADIDMSNPTDVYTSIGASYGS
FT                   EGANLKGQLMLSEKTGDTGQKTGIIFEAKNILNEGDKSPQFTGMVQHPDYGMVPTFNDE
FT                   TSKRSYRLRYGTINTTNGTGWSIDAILADHPFYGSMAVVQAGPVMTIPVTDNFYIWPIL
FT                   YAGGVVIEDNMSQILPPDMAGSTVVSSSGIDVPSLILTGMVYARYAFNDNFWALLSTSY
FT                   TEEIQGKSWSDDIMDGGLQMASFSAEISVAYQMNKRQNVRVNYKTDNSDSTDDSYWIEY
FT                   NHAF"
     MKKRILSIAI LASMTSGLTY AADDADIDMS NPTDVYTSIG ASYGSEGANL KGQLMLSEKT        60
     GDTGQKTGII FEAKNILNEG DKSPQFTGMV QHPDYGMVPT FNDETSKRSY RLRYGTINTT       120
     NGTGWSIDAI LADHPFYGSM AVVQAGPVMT IPVTDNFYIW PILYAGGVVI EDNMSQILPP       180
     DMAGSTVVSS SGIDVPSLIL TGMVYARYAF NDNFWALLST SYTEEIQGKS WSDDIMDGGL       240
     QMASFSAEIS VAYQMNKRQN VRVNYKTDNS DSTDDSYWIE YNHAF                       285
//

If you have problems or comments...

PBIL Back to PBIL home page