(data stored in ACNUC7421 zone)

EMBL: CP000821.PE59

CP000821.PE59        Location/Qualifiers
FT   CDS             complement(70710..71627)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0059"
FT                   /product="flagellar hook-associated protein 3"
FT                   /note="KEGG: spc:Sputcn32_3458 flagellar hook-associated
FT                   protein 3"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34672"
FT                   /db_xref="GOA:A8FP99"
FT                   /db_xref="InterPro:IPR001029"
FT                   /db_xref="InterPro:IPR013384"
FT                   /db_xref="UniProtKB/TrEMBL:A8FP99"
FT                   /protein_id="ABV34672.1"
FT                   /translation="MRVSTQNMYSSNLYNLQNTTSDLARLNEMMSTGKSLLRPSDDPIG
FT                   SVKVIGSERDMAATNQYLKNIESLSTSFGRAESNLSSMTELQSRMREITVAANNGSLSA
FT                   EDRAAYAAEMNELLDALTDTINAKDEGGNYLFSGNLTDTPPISIDASGNYIYQGDASQR
FT                   EVQVSSSSWMPANVTAQEFIFSNGSTDILNQTKEFIAMLEDPTLSPGDPAFDNVAESML
FT                   TTLDDTLTSISSAMTDIGGKQNSLTLIQGSHEEMVLFNKEVIGETEGLDYAQATAEFNV
FT                   KLTTLKVTQQTFVQVSQLSLFGQM"
     MRVSTQNMYS SNLYNLQNTT SDLARLNEMM STGKSLLRPS DDPIGSVKVI GSERDMAATN        60
     QYLKNIESLS TSFGRAESNL SSMTELQSRM REITVAANNG SLSAEDRAAY AAEMNELLDA       120
     LTDTINAKDE GGNYLFSGNL TDTPPISIDA SGNYIYQGDA SQREVQVSSS SWMPANVTAQ       180
     EFIFSNGSTD ILNQTKEFIA MLEDPTLSPG DPAFDNVAES MLTTLDDTLT SISSAMTDIG       240
     GKQNSLTLIQ GSHEEMVLFN KEVIGETEGL DYAQATAEFN VKLTTLKVTQ QTFVQVSQLS       300
     LFGQM                                                                   305
//

If you have problems or comments...

PBIL Back to PBIL home page