(data stored in ACNUC7421 zone)

EMBL: CP000821.PE590

CP000821.PE590       Location/Qualifiers
FT   CDS             720630..721193
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0591"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sbl:Sbal_2970 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35203"
FT                   /db_xref="GOA:A8FQT0"
FT                   /db_xref="InterPro:IPR016087"
FT                   /db_xref="InterPro:IPR016088"
FT                   /db_xref="InterPro:IPR036298"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQT0"
FT                   /protein_id="ABV35203.1"
FT                   /translation="MIKRALVLGTMLFACGNAVAGSEISGVNLPDSITLQDKVLSFNGA
FT                   GVRSKFFIDLYVGSLFTVGQVDQASKVIDSDQPAAIRLNITSGMITSEKMTDAMNEGFD
FT                   RATDGDSASIADSIKEFIATFEEPIQEGDQFTLLSVPGEGVISYKNGKQLSVTRGETFR
FT                   KAVMAIWLGKNPTDKGLKEDMLEG"
     MIKRALVLGT MLFACGNAVA GSEISGVNLP DSITLQDKVL SFNGAGVRSK FFIDLYVGSL        60
     FTVGQVDQAS KVIDSDQPAA IRLNITSGMI TSEKMTDAMN EGFDRATDGD SASIADSIKE       120
     FIATFEEPIQ EGDQFTLLSV PGEGVISYKN GKQLSVTRGE TFRKAVMAIW LGKNPTDKGL       180
     KEDMLEG                                                                 187
//

If you have problems or comments...

PBIL Back to PBIL home page