(data stored in ACNUC7421 zone)

EMBL: CP000821.PE591

CP000821.PE591       Location/Qualifiers
FT   CDS             721346..722806
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0592"
FT                   /product="conserved hypothetical methyl-accepting
FT                   chemotaxis protein"
FT                   /note="KEGG: ppr:PBPRA1115 hypothetical methyl-accepting
FT                   chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35204"
FT                   /db_xref="GOA:A8FQT1"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQT1"
FT                   /protein_id="ABV35204.1"
FT                   /translation="MTPLAIWRAMFMPESHQWRPEQLRFVDTLMFFTLLSLFTGLYSLF
FT                   KWLQHDHTLLIYTSFLLIGAELLAGAIVRFGRMPVLALNVGFFGMVVHALNMIYQGGGV
FT                   LSSTQTLWIPVLIISFFLTANLLMATLWSLGVILFSSRMVANALNGVAMPQMELSPSAL
FT                   ATETWSGLIMPLLVIVVAQGFTAKQRNKAMNAAERAQFDTLATAEKAQQGELQLSEVLD
FT                   KAGDNAGQLSLVANELESQSLDLHQQVNNLNQNCESQASAAEQMSQQLLRMTSDMEQSE
FT                   RFVTEMRERSEVINRQAQSSAESLAASTDAIDKILISNEKIMSVAGLITSVADQTNLLA
FT                   LNAAIEAARAGEHGRGFAVVAEQVRELSAKSNASAVEIRALLDLSKQEVNHGQVVIQAT
FT                   ANELSGIIEQVSETVTDVNQLADTMVHQVQAVQELNSASAEVANSVVQTNQVSESVATQ
FT                   GKQLTQQVDTLKALAEDLRLAMLSKSAA"
     MTPLAIWRAM FMPESHQWRP EQLRFVDTLM FFTLLSLFTG LYSLFKWLQH DHTLLIYTSF        60
     LLIGAELLAG AIVRFGRMPV LALNVGFFGM VVHALNMIYQ GGGVLSSTQT LWIPVLIISF       120
     FLTANLLMAT LWSLGVILFS SRMVANALNG VAMPQMELSP SALATETWSG LIMPLLVIVV       180
     AQGFTAKQRN KAMNAAERAQ FDTLATAEKA QQGELQLSEV LDKAGDNAGQ LSLVANELES       240
     QSLDLHQQVN NLNQNCESQA SAAEQMSQQL LRMTSDMEQS ERFVTEMRER SEVINRQAQS       300
     SAESLAASTD AIDKILISNE KIMSVAGLIT SVADQTNLLA LNAAIEAARA GEHGRGFAVV       360
     AEQVRELSAK SNASAVEIRA LLDLSKQEVN HGQVVIQATA NELSGIIEQV SETVTDVNQL       420
     ADTMVHQVQA VQELNSASAE VANSVVQTNQ VSESVATQGK QLTQQVDTLK ALAEDLRLAM       480
     LSKSAA                                                                  486
//

If you have problems or comments...

PBIL Back to PBIL home page