(data stored in ACNUC7421 zone)

EMBL: CP000821.PE593

CP000821.PE593       Location/Qualifiers
FT   CDS             724186..725883
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0594"
FT                   /product="FAD linked oxidase domain protein"
FT                   /note="KEGG: maq:Maqu_1346 FAD linked oxidase domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0594"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35206"
FT                   /db_xref="GOA:A8FQT3"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQT3"
FT                   /protein_id="ABV35206.1"
FT                   /translation="MQPERRNMNRSQQDNRNWNGWGAREKRMELSQDGAAFICEKLGQA
FT                   KPLGVSTLARVIAKVPDSRLADSELYSTDAEIRLRHARGQSLPDWLAMKSGEFGVFPDA
FT                   VAFPVSGEDIRILMAEAKANGWQLIPYGGGTSVVGHITPCPSDKPVITVSLTKMNRLLE
FT                   LDRVDQIATFGAGVKGPFLEAQLQAHGYTLGHFPQSFELSTLGGWVVTRSSGQQSLGYG
FT                   RIENLFAGGEIETFNGTVDIPTLPASSAGPDWRQLVLGSEGHLGILTQAKVRVTRVAEE
FT                   EFFGVAFMPDWQSGIDCAREIIQQKLPLSMLRVSNSEETHTQLFLSATETQRSWLNRLL
FT                   SLKGVGEGKCMLVYGVTGDLDANRQSYKRLKQVLRRFKGVNTGQRLGKKWAHKRFTFPY
FT                   LRETLWQMGYAIDTLETATNWSNIESMTQKIEHSLRDGLTEFDSKVHVFSHLSHLYGDG
FT                   ASIYTTYLFPVADSYDETYRRWQKLKSTTSTLIVENNGTISHQHGVGSDHAPYLAREKG
FT                   EHVMASLQTCFDYFDPDKQLNPGKLFKAGQTEPVETVHTEKSHTEKEQ"
     MQPERRNMNR SQQDNRNWNG WGAREKRMEL SQDGAAFICE KLGQAKPLGV STLARVIAKV        60
     PDSRLADSEL YSTDAEIRLR HARGQSLPDW LAMKSGEFGV FPDAVAFPVS GEDIRILMAE       120
     AKANGWQLIP YGGGTSVVGH ITPCPSDKPV ITVSLTKMNR LLELDRVDQI ATFGAGVKGP       180
     FLEAQLQAHG YTLGHFPQSF ELSTLGGWVV TRSSGQQSLG YGRIENLFAG GEIETFNGTV       240
     DIPTLPASSA GPDWRQLVLG SEGHLGILTQ AKVRVTRVAE EEFFGVAFMP DWQSGIDCAR       300
     EIIQQKLPLS MLRVSNSEET HTQLFLSATE TQRSWLNRLL SLKGVGEGKC MLVYGVTGDL       360
     DANRQSYKRL KQVLRRFKGV NTGQRLGKKW AHKRFTFPYL RETLWQMGYA IDTLETATNW       420
     SNIESMTQKI EHSLRDGLTE FDSKVHVFSH LSHLYGDGAS IYTTYLFPVA DSYDETYRRW       480
     QKLKSTTSTL IVENNGTISH QHGVGSDHAP YLAREKGEHV MASLQTCFDY FDPDKQLNPG       540
     KLFKAGQTEP VETVHTEKSH TEKEQ                                             565
//

If you have problems or comments...

PBIL Back to PBIL home page