(data stored in ACNUC7421 zone)

EMBL: CP000821.PE6

CP000821.PE6         Location/Qualifiers
FT   CDS             4812..6200
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0006"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="KEGG: shm:Shewmr7_0001 chromosomal replication
FT                   initiator protein DnaA"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34619"
FT                   /db_xref="GOA:A8FP46"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8FP46"
FT                   /protein_id="ABV34619.1"
FT                   /translation="MAVSLWQQCIGRLQDELSAQQFSMWIRPLQAQMDGDTLVLYAPNR
FT                   FVLDWVRDKYINIINQFFTEQMGSDAPKLRFDIGSRPSAPRPVQATAAVERPKFEQNTK
FT                   PAKTSFNVNSPEPAMAANHRSNINRTYQFENFVEGKSNQLGKAAAMQVAENPGGAYNPL
FT                   FLYGGTGLGKTHLLHAVGNGIIKNNPNAKVVYMHSERFVQDMVKALQNNAIEEFKRYYR
FT                   SVDALFIDDIQFFANKDRSQEEFFHTFNALLEGNHQIILTSDKYPKEIDGVEDRLKSRF
FT                   GWGLTVAIEPPELETRVAILMRKAQESGINLPDEVAFFIAKRLRSNVRELEGALNRVIA
FT                   NANFTGRPITIDFVREALRDLLALQEKLVTIDNIQKTVAEYYKIKMADMLSKRRSRSVA
FT                   RPRQVAMALSKELTNHSLPEIGDAFGGRDHTTVLHACRKIAQLREESHDTKEDYANLIR
FT                   TLSS"
     MAVSLWQQCI GRLQDELSAQ QFSMWIRPLQ AQMDGDTLVL YAPNRFVLDW VRDKYINIIN        60
     QFFTEQMGSD APKLRFDIGS RPSAPRPVQA TAAVERPKFE QNTKPAKTSF NVNSPEPAMA       120
     ANHRSNINRT YQFENFVEGK SNQLGKAAAM QVAENPGGAY NPLFLYGGTG LGKTHLLHAV       180
     GNGIIKNNPN AKVVYMHSER FVQDMVKALQ NNAIEEFKRY YRSVDALFID DIQFFANKDR       240
     SQEEFFHTFN ALLEGNHQII LTSDKYPKEI DGVEDRLKSR FGWGLTVAIE PPELETRVAI       300
     LMRKAQESGI NLPDEVAFFI AKRLRSNVRE LEGALNRVIA NANFTGRPIT IDFVREALRD       360
     LLALQEKLVT IDNIQKTVAE YYKIKMADML SKRRSRSVAR PRQVAMALSK ELTNHSLPEI       420
     GDAFGGRDHT TVLHACRKIA QLREESHDTK EDYANLIRTL SS                          462
//

If you have problems or comments...

PBIL Back to PBIL home page