(data stored in ACNUC7421 zone)

EMBL: CP000821.PE60

CP000821.PE60        Location/Qualifiers
FT   CDS             complement(71640..73013)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0060"
FT                   /product="flagellar hook-associated protein FlgK"
FT                   /note="KEGG: spc:Sputcn32_3459 flagellar hook-associated
FT                   protein FlgK"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34673"
FT                   /db_xref="GOA:A8FPA0"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR002371"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPA0"
FT                   /protein_id="ABV34673.1"
FT                   /translation="MSMLNIGMSGLNASMAALNTTSNNVANAMVPGYSRQQVMMSSVGS
FT                   GTYGGGAGVMVDGVRRISDQYEVAQLWNTTSDVGFSKVQASYYGQVEQIFGSDGNNISQ
FT                   GLDLLFASLNSAMEQPNEIAYRQGVLNEARALTHRFNSISEGVNAQLSQIEGQLGASVK
FT                   EVNAQLQTIASFNAEIQASGNNGNVPSSLLDARDAAVDDLAAIVDINVVEDSNGMLNIS
FT                   LAQGQPLLAGTTASTLSVSPDPGNPGMSKISIQFGQSSFPVDESAGGSLGALLDYRDNS
FT                   LMDSIAFIDELAMTIADEFNAVLAGGTDLNGNTPTQDLFTYDPNSPAGSLKLTSGFTAE
FT                   MLAFGQDGTPGDNSNLKELVELANKSFTFNSIGADTTMGDAFASKIGELGSASRQAQVN
FT                   ADTSVKLQMEAQSQWASTSGVNMDEEAVNLIIYQQSYQANAKVISTADQLFQTILNSI"
     MSMLNIGMSG LNASMAALNT TSNNVANAMV PGYSRQQVMM SSVGSGTYGG GAGVMVDGVR        60
     RISDQYEVAQ LWNTTSDVGF SKVQASYYGQ VEQIFGSDGN NISQGLDLLF ASLNSAMEQP       120
     NEIAYRQGVL NEARALTHRF NSISEGVNAQ LSQIEGQLGA SVKEVNAQLQ TIASFNAEIQ       180
     ASGNNGNVPS SLLDARDAAV DDLAAIVDIN VVEDSNGMLN ISLAQGQPLL AGTTASTLSV       240
     SPDPGNPGMS KISIQFGQSS FPVDESAGGS LGALLDYRDN SLMDSIAFID ELAMTIADEF       300
     NAVLAGGTDL NGNTPTQDLF TYDPNSPAGS LKLTSGFTAE MLAFGQDGTP GDNSNLKELV       360
     ELANKSFTFN SIGADTTMGD AFASKIGELG SASRQAQVNA DTSVKLQMEA QSQWASTSGV       420
     NMDEEAVNLI IYQQSYQANA KVISTADQLF QTILNSI                                457
//

If you have problems or comments...

PBIL Back to PBIL home page