(data stored in ACNUC7421 zone)

EMBL: CP000821.PE61

CP000821.PE61        Location/Qualifiers
FT   CDS             complement(73080..73517)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0061"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sdn:Sden_3643 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34674"
FT                   /db_xref="InterPro:IPR019301"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPA1"
FT                   /protein_id="ABV34674.1"
FT                   /translation="MKLDNVQNSHGYLKQMNAGDLIKANGEYGALELVSQQFEAQFLQT
FT                   VLKQMRSASDVMADKDNPLSSQNDGMYRDWHDAELAGRLSQMQSTGLASVMTKQLAGAL
FT                   KSAPQPVASTNQVAEEMSVNPSNTTAMQPALIVPMMAKPSE"
     MKLDNVQNSH GYLKQMNAGD LIKANGEYGA LELVSQQFEA QFLQTVLKQM RSASDVMADK        60
     DNPLSSQNDG MYRDWHDAEL AGRLSQMQST GLASVMTKQL AGALKSAPQP VASTNQVAEE       120
     MSVNPSNTTA MQPALIVPMM AKPSE                                             145
//

If you have problems or comments...

PBIL Back to PBIL home page