(data stored in ACNUC7421 zone)

EMBL: CP000821.PE62

CP000821.PE62        Location/Qualifiers
FT   CDS             complement(73517..74644)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0062"
FT                   /product="flagellar P-ring protein"
FT                   /note="KEGG: spc:Sputcn32_3461 flagellar P-ring protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34675"
FT                   /db_xref="GOA:A8FPA2"
FT                   /db_xref="InterPro:IPR001782"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPA2"
FT                   /protein_id="ABV34675.1"
FT                   /translation="MKKPLILIMSLLLIFTVDSVSAQSQTRYLMDIVDVQGIRENQLVG
FT                   YGLVVGLDGTGDRTQVRFTSQSVVNMLKQFGVQIDDKTDPKLKNVAAVAVHGNVPALAS
FT                   PGQSIDITVSSLGDAKSLRGGTLLMTPLRAVDGEIYAVAQGNLVVGGVSAQGRNGTSVT
FT                   INVPTVGNIPNGALLEAPMHSNFTESETIVLNLRAPSFMTARNIERTVNALFGPDVAQA
FT                   DSNAKVTVRAPESKRERVTFMSMLEELQIEQGRKSPRVVFNSRTGTVVMGGDVVVRKAA
FT                   VSHGNLTVTIIEKESVSQPNGALWGQAQGETVVTTDSQVDIDTGNGHMFVWPEGIALEE
FT                   VVRAVNSLGASPMDLMAILQALDEAGALEAELVVI"
     MKKPLILIMS LLLIFTVDSV SAQSQTRYLM DIVDVQGIRE NQLVGYGLVV GLDGTGDRTQ        60
     VRFTSQSVVN MLKQFGVQID DKTDPKLKNV AAVAVHGNVP ALASPGQSID ITVSSLGDAK       120
     SLRGGTLLMT PLRAVDGEIY AVAQGNLVVG GVSAQGRNGT SVTINVPTVG NIPNGALLEA       180
     PMHSNFTESE TIVLNLRAPS FMTARNIERT VNALFGPDVA QADSNAKVTV RAPESKRERV       240
     TFMSMLEELQ IEQGRKSPRV VFNSRTGTVV MGGDVVVRKA AVSHGNLTVT IIEKESVSQP       300
     NGALWGQAQG ETVVTTDSQV DIDTGNGHMF VWPEGIALEE VVRAVNSLGA SPMDLMAILQ       360
     ALDEAGALEA ELVVI                                                        375
//

If you have problems or comments...

PBIL Back to PBIL home page