(data stored in ACNUC7421 zone)

EMBL: CP000821.PE63

CP000821.PE63        Location/Qualifiers
FT   CDS             complement(74739..75401)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0063"
FT                   /product="flagellar L-ring protein"
FT                   /note="KEGG: spc:Sputcn32_3462 flagellar L-ring protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34676"
FT                   /db_xref="GOA:A8FPA3"
FT                   /db_xref="InterPro:IPR000527"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPA3"
FT                   /protein_id="ABV34676.1"
FT                   /translation="MRHLWIGMLLLLSGCAANFPEADTKPGQPEWAPPEIDYSLPDAKD
FT                   GSAYRQGYMLTLFKDKRAFREGDILTVALDEKTYSSKRADTKANKEQDLSIGAQASAGD
FT                   SSYSGAGDGSLARGFKGSGSSTQQNQLSGSITVTVAKVLPNGALLIRGEKWLRLNQGDE
FT                   YLRLLGLIRTDDIGNDNTISSQRIADARIIYGGQGAIADSNAMGWASRYFNSPWFPL"
     MRHLWIGMLL LLSGCAANFP EADTKPGQPE WAPPEIDYSL PDAKDGSAYR QGYMLTLFKD        60
     KRAFREGDIL TVALDEKTYS SKRADTKANK EQDLSIGAQA SAGDSSYSGA GDGSLARGFK       120
     GSGSSTQQNQ LSGSITVTVA KVLPNGALLI RGEKWLRLNQ GDEYLRLLGL IRTDDIGNDN       180
     TISSQRIADA RIIYGGQGAI ADSNAMGWAS RYFNSPWFPL                             220
//

If you have problems or comments...

PBIL Back to PBIL home page