(data stored in ACNUC7421 zone)

EMBL: CP000821.PE64

CP000821.PE64        Location/Qualifiers
FT   CDS             complement(75446..76231)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0064"
FT                   /product="flagellar basal-body rod protein FlgG"
FT                   /note="KEGG: spc:Sputcn32_3463 flagellar basal-body rod
FT                   protein FlgG"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34677"
FT                   /db_xref="GOA:A8FPA4"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="InterPro:IPR012834"
FT                   /db_xref="InterPro:IPR019776"
FT                   /db_xref="InterPro:IPR020013"
FT                   /db_xref="InterPro:IPR037925"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPA4"
FT                   /protein_id="ABV34677.1"
FT                   /translation="MQSALWVSKTGLTAQDVKMTTIANNLANVNTTGFKRDRVAFNDLF
FT                   YQTQRQPGGQVDELNELPSGLQLGTGTRVVGTQKIFTSGDMLTTNQQLDLAIEGQGFFQ
FT                   IEEANGDLAYSRDGQFYRNSDGLMVTSQGLPLVPNIEIPEDALTITIATDGIVTAQISG
FT                   QAEAQELGQITLVNFTNPTGLEARGDNLYRETGASGAAIEGVAGDQAIGQLRQGALEGA
FT                   NVNVVEEMVEMISTQRAYEMNAKVVSASDDMLKFLNQSL"
     MQSALWVSKT GLTAQDVKMT TIANNLANVN TTGFKRDRVA FNDLFYQTQR QPGGQVDELN        60
     ELPSGLQLGT GTRVVGTQKI FTSGDMLTTN QQLDLAIEGQ GFFQIEEANG DLAYSRDGQF       120
     YRNSDGLMVT SQGLPLVPNI EIPEDALTIT IATDGIVTAQ ISGQAEAQEL GQITLVNFTN       180
     PTGLEARGDN LYRETGASGA AIEGVAGDQA IGQLRQGALE GANVNVVEEM VEMISTQRAY       240
     EMNAKVVSAS DDMLKFLNQS L                                                 261
//

If you have problems or comments...

PBIL Back to PBIL home page