(data stored in ACNUC7421 zone)

EMBL: CP000821.PE65

CP000821.PE65        Location/Qualifiers
FT   CDS             complement(76302..77036)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0065"
FT                   /product="flagellar basal-body rod protein FlgF"
FT                   /note="KEGG: shw:Sputw3181_0475 flagellar basal-body rod
FT                   protein FlgF"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34678"
FT                   /db_xref="GOA:A8FPA5"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="InterPro:IPR020013"
FT                   /db_xref="InterPro:IPR037925"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPA5"
FT                   /protein_id="ABV34678.1"
FT                   /translation="MDKMLYTAAAGAARVMEAQAIRANNLANAETTGFKADLERVNATV
FT                   IPAMGNTLQTRVMAQTQSSGFSHQSGALNPTGRTLDLAIREQGLFSVMTEQGEAYTRSG
FT                   TLVPDTNGQLTIDGRPVAGIDGPIVLPEYRELFVGDDGRISVLAAEGGITEEVGQLKLV
FT                   NPELDTMEKGLDGLFYSRDGQPLQANEQVKVDSGFLESSNVKAVSELIASMDLSRQFEV
FT                   QVKLMKSAEKLAEAGNRLLRNA"
     MDKMLYTAAA GAARVMEAQA IRANNLANAE TTGFKADLER VNATVIPAMG NTLQTRVMAQ        60
     TQSSGFSHQS GALNPTGRTL DLAIREQGLF SVMTEQGEAY TRSGTLVPDT NGQLTIDGRP       120
     VAGIDGPIVL PEYRELFVGD DGRISVLAAE GGITEEVGQL KLVNPELDTM EKGLDGLFYS       180
     RDGQPLQANE QVKVDSGFLE SSNVKAVSEL IASMDLSRQF EVQVKLMKSA EKLAEAGNRL       240
     LRNA                                                                    244
//

If you have problems or comments...

PBIL Back to PBIL home page