(data stored in ACNUC7421 zone)

EMBL: CP000821.PE67

CP000821.PE67        Location/Qualifiers
FT   CDS             complement(78272..78937)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0067"
FT                   /product="flagellar hook capping protein"
FT                   /note="KEGG: shw:Sputw3181_0473 flagellar hook capping
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34680"
FT                   /db_xref="GOA:A8FPA7"
FT                   /db_xref="InterPro:IPR005648"
FT                   /db_xref="InterPro:IPR025963"
FT                   /db_xref="InterPro:IPR025965"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPA7"
FT                   /protein_id="ABV34680.1"
FT                   /translation="MNVNSTTNSSGNDNTSDVMNSPGNDAASIKNEFMTLMIAQIQNQD
FT                   PTNPIDSTEYVTQLAQFSQVESLEQMRLNQSTQMVMMENLGIVQSAQLIGKDAMVPASE
FT                   VTLDTETVHGKVYTGNAVEELSIDIMDESGEVVSTLKLGPQEVGDIEFSIDPEALGLPP
FT                   GKYSIEAQATSGEETLTADTFIQAPIEKIHFVSASGMMMAELGYGLGTVSVLDISEVS"
     MNVNSTTNSS GNDNTSDVMN SPGNDAASIK NEFMTLMIAQ IQNQDPTNPI DSTEYVTQLA        60
     QFSQVESLEQ MRLNQSTQMV MMENLGIVQS AQLIGKDAMV PASEVTLDTE TVHGKVYTGN       120
     AVEELSIDIM DESGEVVSTL KLGPQEVGDI EFSIDPEALG LPPGKYSIEA QATSGEETLT       180
     ADTFIQAPIE KIHFVSASGM MMAELGYGLG TVSVLDISEV S                           221
//

If you have problems or comments...

PBIL Back to PBIL home page