(data stored in ACNUC7421 zone)

EMBL: CP000821.PE68

CP000821.PE68        Location/Qualifiers
FT   CDS             complement(79003..79422)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0068"
FT                   /product="flagellar basal-body rod protein FlgC"
FT                   /note="KEGG: shw:Sputw3181_0472 flagellar basal-body rod
FT                   protein FlgC"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34681"
FT                   /db_xref="GOA:A8FPA8"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR006299"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPA8"
FT                   /protein_id="ABV34681.1"
FT                   /translation="MSFGEIYQIAGAGMHAQSIRLNTVASNLANAGAAAETQDSAYRAL
FT                   KPVFSTIYNQTQAGEVSGAQVEVAAIVETDAPLDMRYEPDHPFADEQGYVAYSNVNTVE
FT                   EMADMMAASRSFETSVEVMNQARSMQQGLLQLGTK"
     MSFGEIYQIA GAGMHAQSIR LNTVASNLAN AGAAAETQDS AYRALKPVFS TIYNQTQAGE        60
     VSGAQVEVAA IVETDAPLDM RYEPDHPFAD EQGYVAYSNV NTVEEMADMM AASRSFETSV       120
     EVMNQARSMQ QGLLQLGTK                                                    139
//

If you have problems or comments...

PBIL Back to PBIL home page