(data stored in ACNUC7421 zone)

EMBL: CP000821.PE69

CP000821.PE69        Location/Qualifiers
FT   CDS             complement(79521..79871)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0069"
FT                   /product="flagellar basal-body rod protein FlgB"
FT                   /note="KEGG: shw:Sputw3181_0471 flagellar basal-body rod
FT                   protein FlgB"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34682"
FT                   /db_xref="GOA:A8FPA9"
FT                   /db_xref="InterPro:IPR006300"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPA9"
FT                   /protein_id="ABV34682.1"
FT                   /translation="MAINLDAALGIHPQTLDFRVERTKILAGNLANAETPGYKAKDLNF
FT                   QALMSGINAGMPASNQYEVGYRVPYQTSADQNTVELGKEQARYSQNAMDYQTSLTFLNM
FT                   KISGLKSAIEGQ"
     MAINLDAALG IHPQTLDFRV ERTKILAGNL ANAETPGYKA KDLNFQALMS GINAGMPASN        60
     QYEVGYRVPY QTSADQNTVE LGKEQARYSQ NAMDYQTSLT FLNMKISGLK SAIEGQ           116
//

If you have problems or comments...

PBIL Back to PBIL home page