(data stored in ACNUC7421 zone)

EMBL: CP000821.PE7

CP000821.PE7         Location/Qualifiers
FT   CDS             6220..7320
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0007"
FT                   /product="DNA-directed DNA polymerase"
FT                   /EC_number="2.7.7.7"
FT                   /note="KEGG: slo:Shew_0002 DNA polymerase III, beta
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34620"
FT                   /db_xref="GOA:A8FP47"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:A8FP47"
FT                   /protein_id="ABV34620.1"
FT                   /translation="MKFSIDRDALLKPLQLVTGAVERRHNLPILANLLVEVSGHSLKMT
FT                   GTDLEVELVGQVQLEGDVQEGRTTIPAKKFLDIVKSLPDQVELKIEQQENRLLLRSGRS
FT                   RFTLATLPAEEYPNVEAFQADIEFTIKQGTLKSLIDATQFSMANQDVRYYLNGLLLETE
FT                   GNVLRAIATDGHRLALSHRMVEESLPEKQVIVPRKGVVELQRLFEGEDLDITIAIGDNA
FT                   IRATTGSAVFTSKLVDGRFPDYRRVLPKGGDKIVIASRNHLKQALLRASILSNEKFRGV
FT                   RVQLENNLIKITANNPEQEEAEEILDVEYENTPLEIGFNVSYLLDVLNNLPSDDVRITL
FT                   IDGNSSALIENHIEENSMYVVMPMRL"
     MKFSIDRDAL LKPLQLVTGA VERRHNLPIL ANLLVEVSGH SLKMTGTDLE VELVGQVQLE        60
     GDVQEGRTTI PAKKFLDIVK SLPDQVELKI EQQENRLLLR SGRSRFTLAT LPAEEYPNVE       120
     AFQADIEFTI KQGTLKSLID ATQFSMANQD VRYYLNGLLL ETEGNVLRAI ATDGHRLALS       180
     HRMVEESLPE KQVIVPRKGV VELQRLFEGE DLDITIAIGD NAIRATTGSA VFTSKLVDGR       240
     FPDYRRVLPK GGDKIVIASR NHLKQALLRA SILSNEKFRG VRVQLENNLI KITANNPEQE       300
     EAEEILDVEY ENTPLEIGFN VSYLLDVLNN LPSDDVRITL IDGNSSALIE NHIEENSMYV       360
     VMPMRL                                                                  366
//

If you have problems or comments...

PBIL Back to PBIL home page