(data stored in ACNUC7421 zone)

EMBL: CP000821.PE70

CP000821.PE70        Location/Qualifiers
FT   CDS             79958..80704
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0070"
FT                   /product="SAF domain"
FT                   /note="KEGG: shw:Sputw3181_0470 SAF domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34683"
FT                   /db_xref="GOA:A8FPB0"
FT                   /db_xref="InterPro:IPR013974"
FT                   /db_xref="InterPro:IPR017585"
FT                   /db_xref="InterPro:IPR039246"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPB0"
FT                   /protein_id="ABV34683.1"
FT                   /translation="MGYVFIVRWRGIAASCFLMLLSCLLPLRAGAEESLDVKLQIENQL
FT                   TRLLSQEIAQWQRQAGLKSVEHNIEVRVPSGAAKLKLCPEPLLIDTGSGLVFGNVQRKV
FT                   LCASQAWSLFVRAKVKVTARLPVANRAMKRGEFIGAQDIEWHPIVLGASDRDLLTKTDD
FT                   IIGRQVNRKLRRHRAIQLHHLNAPQWVNIGDRVIIEARSQGFYANMAGEALESGGEGEA
FT                   IRVKNLSSGKVITAFPTAKGRVTTVF"
     MGYVFIVRWR GIAASCFLML LSCLLPLRAG AEESLDVKLQ IENQLTRLLS QEIAQWQRQA        60
     GLKSVEHNIE VRVPSGAAKL KLCPEPLLID TGSGLVFGNV QRKVLCASQA WSLFVRAKVK       120
     VTARLPVANR AMKRGEFIGA QDIEWHPIVL GASDRDLLTK TDDIIGRQVN RKLRRHRAIQ       180
     LHHLNAPQWV NIGDRVIIEA RSQGFYANMA GEALESGGEG EAIRVKNLSS GKVITAFPTA       240
     KGRVTTVF                                                                248
//

If you have problems or comments...

PBIL Back to PBIL home page