(data stored in ACNUC7421 zone)

EMBL: CP000821.PE71

CP000821.PE71        Location/Qualifiers
FT   CDS             80780..81064
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0071"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: shw:Sputw3181_0469 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34684"
FT                   /db_xref="GOA:A8FPB1"
FT                   /db_xref="InterPro:IPR007412"
FT                   /db_xref="InterPro:IPR031316"
FT                   /db_xref="InterPro:IPR035890"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPB1"
FT                   /protein_id="ABV34684.1"
FT                   /translation="MEINKVNSAISAEISTKKESVTLPELTDKKPVSQGSTPKAVSDDW
FT                   HLLARSQPQLQQLEDLDRTKMAEIRQSLRDGSFELNITAISEAMLQQHG"
     MEINKVNSAI SAEISTKKES VTLPELTDKK PVSQGSTPKA VSDDWHLLAR SQPQLQQLED        60
     LDRTKMAEIR QSLRDGSFEL NITAISEAML QQHG                                    94
//

If you have problems or comments...

PBIL Back to PBIL home page