(data stored in ACNUC7421 zone)

EMBL: CP000821.PE73

CP000821.PE73        Location/Qualifiers
FT   CDS             complement(81517..81951)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0073"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sdn:Sden_3655 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34686"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPB3"
FT                   /protein_id="ABV34686.1"
FT                   /translation="MKQLLRLCQQEEKKLSQLGRQRGEAQQRIEAITQQQHNLNRMLHE
FT                   YQQHTPKIANSLLLQNSTNLQLALRPMQARLTRQEILLQQEHRRVDGLWRQQLGRQQGI
FT                   KWLYQKRKQDKIELNNRQEQKQLDDLASRARTNRSQSDES"
     MKQLLRLCQQ EEKKLSQLGR QRGEAQQRIE AITQQQHNLN RMLHEYQQHT PKIANSLLLQ        60
     NSTNLQLALR PMQARLTRQE ILLQQEHRRV DGLWRQQLGR QQGIKWLYQK RKQDKIELNN       120
     RQEQKQLDDL ASRARTNRSQ SDES                                              144
//

If you have problems or comments...

PBIL Back to PBIL home page