(data stored in ACNUC7421 zone)

EMBL: CP000821.PE75

CP000821.PE75        Location/Qualifiers
FT   CDS             complement(83299..84057)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0075"
FT                   /product="flagellar assembly protein FliH"
FT                   /note="KEGG: sbl:Sbal_3977 flagellar assembly protein FliH"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34688"
FT                   /db_xref="GOA:A8FPB5"
FT                   /db_xref="InterPro:IPR000563"
FT                   /db_xref="InterPro:IPR018035"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPB5"
FT                   /protein_id="ABV34688.1"
FT                   /translation="MTFPVDKMDPKWRLKKELARRHRFAPLVQQPPMEGEAGTGWQDYQ
FT                   EAFDKGYEEGVAKGHLEGFESGSEEGRRSGHASGFNQGRIEGNLKGKEAIDEQLNQLIA
FT                   PLGALKSILEEGHTHQVSQQQTMLLDLIRRVAQQVIRCELTLQPQQILSLVEETLTALP
FT                   DTRSEIKIHLEPNAVNKLKELASDKIQDWTLVADPSISAGGCRIVSDKSDADASVETRL
FT                   NVCMDQVSAKLKEPETSNTNSEAELPIDVA"
     MTFPVDKMDP KWRLKKELAR RHRFAPLVQQ PPMEGEAGTG WQDYQEAFDK GYEEGVAKGH        60
     LEGFESGSEE GRRSGHASGF NQGRIEGNLK GKEAIDEQLN QLIAPLGALK SILEEGHTHQ       120
     VSQQQTMLLD LIRRVAQQVI RCELTLQPQQ ILSLVEETLT ALPDTRSEIK IHLEPNAVNK       180
     LKELASDKIQ DWTLVADPSI SAGGCRIVSD KSDADASVET RLNVCMDQVS AKLKEPETSN       240
     TNSEAELPID VA                                                           252
//

If you have problems or comments...

PBIL Back to PBIL home page