(data stored in ACNUC7421 zone)

EMBL: CP000821.PE76

CP000821.PE76        Location/Qualifiers
FT   CDS             complement(84057..85070)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0076"
FT                   /product="flagellar motor switch protein FliG"
FT                   /note="KEGG: sbl:Sbal_3978 flagellar motor switch protein
FT                   FliG"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34689"
FT                   /db_xref="GOA:A8FPB6"
FT                   /db_xref="InterPro:IPR000090"
FT                   /db_xref="InterPro:IPR011002"
FT                   /db_xref="InterPro:IPR023087"
FT                   /db_xref="InterPro:IPR028263"
FT                   /db_xref="InterPro:IPR032779"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPB6"
FT                   /protein_id="ABV34689.1"
FT                   /translation="MNKSELGIKMDNLEQAAMLLLSMGEKGAAQVMAHLDRNDVQHLSH
FT                   KMARLSSITQQEAEAVLGRFFMRYQEQSGIARASRSYLQKTLDLALGDRVAKSLIDSIY
FT                   GDEIKTLVKRLEWVDPQLLAREITNEHSQLQAVLLGLLPPESAAQVLLSLPAEGQDEVL
FT                   VRIAQLGELDRDVVDELRQLVERCMLIAMEKSHTQVAGIRQVADILNRFEGDREQLMDM
FT                   IKLHDTKLASDVADNMFDFIILGRQKPETLQEIMAIVPPEMLALALKGIDSELKSTLLL
FT                   ALPKRMSSAIETQVEAIGAVPLSQATSARKEIMELAKQMMDDGEIELQLFEEQVVE"
     MNKSELGIKM DNLEQAAMLL LSMGEKGAAQ VMAHLDRNDV QHLSHKMARL SSITQQEAEA        60
     VLGRFFMRYQ EQSGIARASR SYLQKTLDLA LGDRVAKSLI DSIYGDEIKT LVKRLEWVDP       120
     QLLAREITNE HSQLQAVLLG LLPPESAAQV LLSLPAEGQD EVLVRIAQLG ELDRDVVDEL       180
     RQLVERCMLI AMEKSHTQVA GIRQVADILN RFEGDREQLM DMIKLHDTKL ASDVADNMFD       240
     FIILGRQKPE TLQEIMAIVP PEMLALALKG IDSELKSTLL LALPKRMSSA IETQVEAIGA       300
     VPLSQATSAR KEIMELAKQM MDDGEIELQL FEEQVVE                                337
//

If you have problems or comments...

PBIL Back to PBIL home page