(data stored in ACNUC7421 zone)

EMBL: CP000821.PE77

CP000821.PE77        Location/Qualifiers
FT   CDS             complement(85129..86841)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0077"
FT                   /product="flagellar M-ring protein FliF"
FT                   /note="KEGG: sbl:Sbal_3979 flagellar M-ring protein FliF"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34690"
FT                   /db_xref="GOA:A8FPB7"
FT                   /db_xref="InterPro:IPR000067"
FT                   /db_xref="InterPro:IPR006182"
FT                   /db_xref="InterPro:IPR013556"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPB7"
FT                   /protein_id="ABV34690.1"
FT                   /translation="MSTTLAQPSPNMTDVRDKSEIVSSLKTKWQQFNRGDRQVLVLAIL
FT                   ASVVACVIVLLLWTASQGYRPLYGQQEKVETSQIIEVLEAEGINYRLEANSGLVLVQED
FT                   KLGKARMLLAARGVKAKVPSGMESLDNSGIGTSQFMEQAKYRHSLEGELSRTIMALKAV
FT                   RTARVHLAIPKRTLFIRQQPELPSASVMLDLYAGSKIQPGQIEAIANLVAGSVTGMTPE
FT                   RVQIVDQEGNHLSSGIAINQDITQARDRQLKYTQELEQSLINRASSMLAPVLGKENFQV
FT                   QIAAQVNFNQVEETRESLDPQSVVTQEKQSINDTNSDIAMGIPGALTNQAPKAQANKTE
FT                   ENTRRNLNQQESRQYEVGRSVRHTRFQQMQLENLSVSVLLNNQAAGENGWNEAQVSQLG
FT                   TMVKDSIGYSMQRGDQFSINSFDFAPVQIAQFEPMPWWQTEGYQAYLRYFIGGILGFGL
FT                   IFFVLRPLVSHLTRTAEHSLKEELPQVEPALEAPSSSSISGVQSGDGQALADQLMGLEQ
FT                   DKSDTDWLSNQGLPAPGSPLTVKMEHLSLLANQEPARVAEVIAHWIGDNENER"
     MSTTLAQPSP NMTDVRDKSE IVSSLKTKWQ QFNRGDRQVL VLAILASVVA CVIVLLLWTA        60
     SQGYRPLYGQ QEKVETSQII EVLEAEGINY RLEANSGLVL VQEDKLGKAR MLLAARGVKA       120
     KVPSGMESLD NSGIGTSQFM EQAKYRHSLE GELSRTIMAL KAVRTARVHL AIPKRTLFIR       180
     QQPELPSASV MLDLYAGSKI QPGQIEAIAN LVAGSVTGMT PERVQIVDQE GNHLSSGIAI       240
     NQDITQARDR QLKYTQELEQ SLINRASSML APVLGKENFQ VQIAAQVNFN QVEETRESLD       300
     PQSVVTQEKQ SINDTNSDIA MGIPGALTNQ APKAQANKTE ENTRRNLNQQ ESRQYEVGRS       360
     VRHTRFQQMQ LENLSVSVLL NNQAAGENGW NEAQVSQLGT MVKDSIGYSM QRGDQFSINS       420
     FDFAPVQIAQ FEPMPWWQTE GYQAYLRYFI GGILGFGLIF FVLRPLVSHL TRTAEHSLKE       480
     ELPQVEPALE APSSSSISGV QSGDGQALAD QLMGLEQDKS DTDWLSNQGL PAPGSPLTVK       540
     MEHLSLLANQ EPARVAEVIA HWIGDNENER                                        570
//

If you have problems or comments...

PBIL Back to PBIL home page