(data stored in ACNUC7421 zone)

EMBL: CP000821.PE78

CP000821.PE78        Location/Qualifiers
FT   CDS             complement(86938..87276)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0078"
FT                   /product="flagellar hook-basal body complex subunit FliE"
FT                   /note="KEGG: shw:Sputw3181_0462 flagellar hook-basal body
FT                   complex subunit FliE"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34691"
FT                   /db_xref="GOA:A8FPB8"
FT                   /db_xref="InterPro:IPR001624"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPB8"
FT                   /protein_id="ABV34691.1"
FT                   /translation="MSNSTLVNPQSMMDTLSIHSEMAKGAIKITPNPKDHGLQPASFTE
FT                   LMESKVAAVNLDQNTSSALMRAVDSGESDDLVGAMVASQKASLSFSTMIQIRNRLVQAF
FT                   DEVMKMPL"
     MSNSTLVNPQ SMMDTLSIHS EMAKGAIKIT PNPKDHGLQP ASFTELMESK VAAVNLDQNT        60
     SSALMRAVDS GESDDLVGAM VASQKASLSF STMIQIRNRL VQAFDEVMKM PL               112
//

If you have problems or comments...

PBIL Back to PBIL home page