(data stored in ACNUC7421 zone)

EMBL: CP000821.PE8

CP000821.PE8         Location/Qualifiers
FT   CDS             7614..8696
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0008"
FT                   /product="DNA replication and repair protein RecF"
FT                   /note="KEGG: slo:Shew_0003 DNA replication and repair
FT                   protein RecF"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34621"
FT                   /db_xref="GOA:A8FP48"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8FP48"
FT                   /protein_id="ABV34621.1"
FT                   /translation="MSLTRLHIETFRNITSAQLLPGEGINLIYGHNGSGKTSILEAIYF
FT                   LGMGRSFRSHLSQRVIQHSDDKLTLFANLNVLDKESKIGLRRFRSGETEVKIDGDKVKR
FT                   LSTLAESLPIQVITPESFALLFEGPKSRRQFIDWGAFHCDKSFHSAWVNVKRILKQRNQ
FT                   LLKNETSYSQIQFWDKELVRYSEVVTDIRTRYVNSLNEQLKGIIGEFLPLVDVKVSFTR
FT                   GWDSKTDYAQLLEMQYPRDLASGNTGSGPHKADLRLRVGTLPVQDALSRGQLKLLVCAL
FT                   RIAQGKLLKQQIDKNSIYLVDDLPAELDAKHRQLLLQQLIDTGAQVFVTAIEPAAILDS
FT                   LITPPSKTFHVEHGRVTVIE"
     MSLTRLHIET FRNITSAQLL PGEGINLIYG HNGSGKTSIL EAIYFLGMGR SFRSHLSQRV        60
     IQHSDDKLTL FANLNVLDKE SKIGLRRFRS GETEVKIDGD KVKRLSTLAE SLPIQVITPE       120
     SFALLFEGPK SRRQFIDWGA FHCDKSFHSA WVNVKRILKQ RNQLLKNETS YSQIQFWDKE       180
     LVRYSEVVTD IRTRYVNSLN EQLKGIIGEF LPLVDVKVSF TRGWDSKTDY AQLLEMQYPR       240
     DLASGNTGSG PHKADLRLRV GTLPVQDALS RGQLKLLVCA LRIAQGKLLK QQIDKNSIYL       300
     VDDLPAELDA KHRQLLLQQL IDTGAQVFVT AIEPAAILDS LITPPSKTFH VEHGRVTVIE       360
//

If you have problems or comments...

PBIL Back to PBIL home page