(data stored in ACNUC7421 zone)

EMBL: CP000821.PE80

CP000821.PE80        Location/Qualifiers
FT   CDS             complement(88607..89521)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0080"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ppr:PBPRA0019 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34693"
FT                   /db_xref="GOA:A8FPC0"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="InterPro:IPR041544"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPC0"
FT                   /protein_id="ABV34693.1"
FT                   /translation="MKISAHIKLYSLSFFLLISNIATASSTRYQTPLEQAKWDFTGNRF
FT                   ICQIEHKVNGFGEFKLIARPGTSLSLQLDADWLSFEQTTSQAKVVSPSWSQTDSLSSGA
FT                   THLKWHGRTAISDDTTSKFLEALEQGLAWQVLILARDGISYKVETSPINTQAIANKFKL
FT                   CRQELLPKPFSYVRRVDIQFESGTSKLTAAHEVDLEAIAQYVQADATVKEILVDAHADA
FT                   SGEHLANLVLSKERADEVASRLFELGIQKQKIQVRHHGARSPIVSNNSPEGREINRRVT
FT                   IRLIKSHTKTANSNPTGVNNASL"
     MKISAHIKLY SLSFFLLISN IATASSTRYQ TPLEQAKWDF TGNRFICQIE HKVNGFGEFK        60
     LIARPGTSLS LQLDADWLSF EQTTSQAKVV SPSWSQTDSL SSGATHLKWH GRTAISDDTT       120
     SKFLEALEQG LAWQVLILAR DGISYKVETS PINTQAIANK FKLCRQELLP KPFSYVRRVD       180
     IQFESGTSKL TAAHEVDLEA IAQYVQADAT VKEILVDAHA DASGEHLANL VLSKERADEV       240
     ASRLFELGIQ KQKIQVRHHG ARSPIVSNNS PEGREINRRV TIRLIKSHTK TANSNPTGVN       300
     NASL                                                                    304
//

If you have problems or comments...

PBIL Back to PBIL home page