(data stored in ACNUC7421 zone)

EMBL: CP000821.PE81

CP000821.PE81        Location/Qualifiers
FT   CDS             90188..91054
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0081"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: shw:Sputw3181_0460 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34694"
FT                   /db_xref="InterPro:IPR001543"
FT                   /db_xref="InterPro:IPR036429"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPC1"
FT                   /protein_id="ABV34694.1"
FT                   /translation="MKTTAKACLLKASRCERVRPVALIQEKLARSRLLIQVDACQRSFL
FT                   EAANGVLNPIIRQGHHALSSISLTDSDQSVVPDINNGWFLLRYQRLPLAWWRIDKCTLD
FT                   QLASGYYGSLATLLKSPLRAPSQSEFRLAKKLMLAALKVLPTAELDENALELELVVNST
FT                   PIDSPVIWEIAFPVEHKVAPMLFCMTEHLLGLMSEQPSQYMATPDLAEKLSYRLRQIPI
FT                   KILFELGRQSTPVTSLHGLEVGDILPMNLHSRCPVTVGKRPLFYAAIHTHDGQMVAKLA
FT                   QDIYQQG"
     MKTTAKACLL KASRCERVRP VALIQEKLAR SRLLIQVDAC QRSFLEAANG VLNPIIRQGH        60
     HALSSISLTD SDQSVVPDIN NGWFLLRYQR LPLAWWRIDK CTLDQLASGY YGSLATLLKS       120
     PLRAPSQSEF RLAKKLMLAA LKVLPTAELD ENALELELVV NSTPIDSPVI WEIAFPVEHK       180
     VAPMLFCMTE HLLGLMSEQP SQYMATPDLA EKLSYRLRQI PIKILFELGR QSTPVTSLHG       240
     LEVGDILPMN LHSRCPVTVG KRPLFYAAIH THDGQMVAKL AQDIYQQG                    288
//

If you have problems or comments...

PBIL Back to PBIL home page