(data stored in ACNUC7421 zone)

EMBL: CP000821.PE82

CP000821.PE82        Location/Qualifiers
FT   CDS             91135..91491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0082"
FT                   /product="flagellar motor switch protein FliN"
FT                   /note="KEGG: shw:Sputw3181_0459 flagellar motor switch
FT                   protein FliN"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34695"
FT                   /db_xref="GOA:A8FPC2"
FT                   /db_xref="InterPro:IPR001172"
FT                   /db_xref="InterPro:IPR001543"
FT                   /db_xref="InterPro:IPR012826"
FT                   /db_xref="InterPro:IPR036429"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPC2"
FT                   /protein_id="ABV34695.1"
FT                   /translation="MTEHTMLQDDDFLLDDNLFGEEEAVQEMSSPKPVKDISFFHQLPV
FT                   QVTLELASAEMSLGELTRMGEGDVVALDRMVGEPLDIRVNGALLGRGEVVEVNGRYGVR
FT                   LLEVEAISLTGAND"
     MTEHTMLQDD DFLLDDNLFG EEEAVQEMSS PKPVKDISFF HQLPVQVTLE LASAEMSLGE        60
     LTRMGEGDVV ALDRMVGEPL DIRVNGALLG RGEVVEVNGR YGVRLLEVEA ISLTGAND         118
//

If you have problems or comments...

PBIL Back to PBIL home page