(data stored in ACNUC7421 zone)

EMBL: CP000821.PE83

CP000821.PE83        Location/Qualifiers
FT   CDS             91494..92222
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0083"
FT                   /product="Triacylglycerol lipase"
FT                   /EC_number="3.1.1.3"
FT                   /note="KEGG: sdn:Sden_3664 flagellar biosynthetic protein
FT                   FliP"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34696"
FT                   /db_xref="GOA:A8FPC3"
FT                   /db_xref="InterPro:IPR005837"
FT                   /db_xref="InterPro:IPR005838"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPC3"
FT                   /protein_id="ABV34696.1"
FT                   /translation="MLRALLLLFCLLAPSAFANDGFTLFTLDDGQQSQSVNIKLEILAL
FT                   MTVLSFLPALLMMLTSFTRIIVVLAILRQALGLQQSPPNKVLLGIALVLTLFVMRPVGQ
FT                   VMYDEAYLPYDQGLIELPEAVNIGVVPLRKFMLAQTRETDLEQMLKIADEPVTLTADEI
FT                   PFFVLMPAFVLSELKTAFQIGFLLFLPFLVIDLVVASVLMSMGMMMLSPLIISLPFKLM
FT                   VFVLVDGWSMTVSTLVASFG"
     MLRALLLLFC LLAPSAFAND GFTLFTLDDG QQSQSVNIKL EILALMTVLS FLPALLMMLT        60
     SFTRIIVVLA ILRQALGLQQ SPPNKVLLGI ALVLTLFVMR PVGQVMYDEA YLPYDQGLIE       120
     LPEAVNIGVV PLRKFMLAQT RETDLEQMLK IADEPVTLTA DEIPFFVLMP AFVLSELKTA       180
     FQIGFLLFLP FLVIDLVVAS VLMSMGMMML SPLIISLPFK LMVFVLVDGW SMTVSTLVAS       240
     FG                                                                      242
//

If you have problems or comments...

PBIL Back to PBIL home page